KEGG   Brucella microti: BMI_II334Help
Entry
BMI_II334         CDS       T00955                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bmr  Brucella microti
Pathway
bmr00250  Alanine, aspartate and glutamate metabolism
bmr00410  beta-Alanine metabolism
bmr00430  Taurine and hypotaurine metabolism
bmr00650  Butanoate metabolism
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
bmr01120  Microbial metabolism in diverse environments
bmr02024  Quorum sensing
Module
bmr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BMI_II334 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMI_II334 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMI_II334 (gadB)
   00430 Taurine and hypotaurine metabolism
    BMI_II334 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BMI_II334 (gadB)
Enzymes [BR:bmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BMI_II334 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACU49468
UniProt: C7LHI0
LinkDB All DBs
Position
2:319344..320762
Genome map
AA seq 472 aa AA seqDB search
MKITLEVIMTGSNYPARDLIASVFGTEALQEIAASRGFPEKEMQANAVYQIIHDELFLDG
NARQNLATFCQTWDDDYVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWNAPKFA
DNATGTNTIGSSEACMLGGMAMKWRWRKKMQEMGKPTDKPNFVCGPVQVCWHKFARYWDV
EIREIPMEPGRLFMGPEQMLEAVDENTIGVVPTFGVTYTGNYEFPEPLQDALDKLQKTKG
LDIDIHVDAASGGFLAPFCAPDIPWDFRLPRVKSISASGHKYGLAPLGCGWVVWRDKEAL
PEELIFNVDYLGGQVGTFAINFSRPAGQVISQYYEFMRLGREGYTKVQQAAYRVAQYIAR
EIEPLGPYEFICAGEEKGGIPAVCFRIREGEDPGYSLYDLSERLRLTGWQVPAFALSGKA
SDITVMRVMCRRGFEMDLAALFIRDFKAGIEFFKSHPSPKITPSMGTGFHHT
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattaccctggaggtaataatgactggttcaaactatccggcgcgggatttgatt
gcctctgtttttggcaccgaggctttacaggaaattgctgcttcgcgtggttttcccgaa
aaggaaatgcaggcgaacgctgtttaccagattattcatgacgaactgtttctcgatggt
aatgcccgtcagaatctggcgaccttctgtcagacatgggatgatgattacgtccacaag
ctgatggacctttcgatcaacaagaactggatcgacaaggaggaatatccccagtcggcg
gccattgatctgcgctgtgtcaacatggtcgcggacctctggaatgcacccaaattcgcc
gataatgccacaggcaccaatacgatcgggtccagcgaggcctgtatgcttggtggtatg
gccatgaaatggcgctggcgcaagaagatgcaggaaatgggcaagccgacggacaagccc
aatttcgtttgtggcccggtgcaggtgtgttggcacaaattcgcccggtactgggatgtc
gagatccgggaaattccgatggagcctggccgcctgttcatgggaccagaacaaatgctt
gaagccgttgatgaaaataccatcggcgtcgtgcccactttcggcgtgacctataccggc
aattatgaatttcccgaaccgttgcaggatgcgctggacaagctgcaaaagaccaagggt
cttgatatcgatatccatgtcgatgcggcaagcggcggctttctggcaccattttgcgcg
cccgatattccgtgggatttccgcctgccgcgcgtgaagtcgatcagcgcgtcaggccat
aaatacggtctcgcaccgcttggctgtggctgggttgtctggcgcgacaaagaggccctg
ccggaagagctgatcttcaatgtggattatctcggtggacaggttggcactttcgcaatc
aatttctcgcggcctgccggtcaggtcatttcacaatattacgaattcatgcgtcttggc
cgcgaaggctacaccaaggtgcagcaggcggcctaccgcgtggcgcaatatatagccagg
gagatcgagccgcttgggccttatgaattcatctgcgcgggcgaggagaaaggcggcatt
cccgccgtctgtttccgcatccgtgaaggcgaagaccccggttattcgctctatgatctg
tcggaacggctgcgtctgaccggatggcaggttcccgctttcgctctttcgggcaaggcg
tcggatatcactgtcatgcgcgtcatgtgccgccgcggtttcgagatggatctggctgca
ctcttcattcgggatttcaaggctgggatcgagttcttcaaatcgcatccttcaccgaag
attaccccgtcgatgggaaccggctttcaccacacataa

DBGET integrated database retrieval system