KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0868Help
Entry
Bmul_0868         CDS       T00624                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bmul_0868
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bmul_0868
   00680 Methane metabolism
    Bmul_0868
Enzymes [BR:bmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bmul_0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(948990..952004)
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSVRATRRNAALPSSDAPTSAVATAANGRAKPATKPKDPIRQTKRAATTRTASART
AATPKSGGRTREDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
REAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AHALDKLKTTGNASKRVLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTARERQHNEAMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLEELPALYGDIE
AALAEHGLAARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRATPYADSDEFVADLKVLTASLAEHHGASLAAPRLAPLMRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVVADYASLEEADKLRVLLAALADPRPLRSPYLEYSA
LAQSELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGTLGAPDG
HAKNALMVIPLFETIPDLRDASRIMREYFALPGVDALIHHQGDEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVELFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEGAMQTLSDTAMAA
YRALVYETPGFTDYFFASTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVAAYLDGAADAAERGKRLALLKKMNKTWPFFANLLSNMDMVLAKTD
LAVASRYAELVPDRKLRNAVFGRIVAEWERTSHALAEITGHEERLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggtgcgcgcgacgcgccgcaatgctgccctgccctcctccgac
gccccgacgagcgccgtcgccaccgccgcgaacggccgtgcgaaaccggcaacgaaaccg
aaagacccgatacgtcagacaaaacgtgcggccacgacgcgcacggcgagcgcgcgcacc
gcggcaacgccgaagtcgggcgggcgcacgcgcgaagacaaggatcgtccgctgttcgaa
gacatccgtttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgacacg
gtgttcgacgtcgtcgaaacgattcgtcagaccgcggtcaagttccgccgcgaggacgac
cgcgaagccgcacagacgctcgagaagaagctgcgcaagctgacgcccgagcagacggtc
agcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgccgaggatcgccac
cacaaccgccgccgccgcatccacgcgctcgcgggctcggcgccgcagccgggcacggtc
gcgcacgcgctcgacaagctgaaaacgaccggcaatgcgtcgaagcgcgtgctgcagcgc
ttcttcgacgacgcgctgatcgtgccggtactgaccgcgcacccgaccgaagtgcagcgc
aagagcattctcgacgcgcagcacgacatcgcgcggctgctcgccgaacgcgatcaggaa
ctgaccgcgcgcgagcgccagcacaacgaagcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacgcggatgctgcgcgacgcgcgcctgacggtcggcgacgaaatcgagaacgcg
ctgtcgtactaccgcgcgacgttcctcgaggaattgcccgcgctgtacggcgacatcgag
gccgcgctcgcggagcacgggctggccgcgcgcgtgccggcgttcttccagatgggcagc
tggatcggcggcgatcgcgacggcaatccgaacgtgacggccgccacgctcgacgaagcg
atcaaccgccaggccgccgtgatcctcgagcactatctcgagcaggtgcacaagctgggc
gccgagctgtcggtgtcgaacctgctggtcggcgcgaacgatgcggtgaaggcgctcgcg
gccgcgtcgcccgaccagtcgccgcaccgcgtcgacgagccgtaccgccgcgcgctgatc
ggcatctatacgcgccttgccgcaagtgcgcgcgtgcggctcggcgaaggcacggtgccg
gtgcgcagcgcagggcgcggcgcgccgcccgtgcgcgcgacgccgtatgcggattccgac
gagttcgtcgcggacctgaaggtgttgaccgcatcgctcgccgaacatcacggcgcgtcg
ctcgccgcgccgcgcctcgcgccgctcatgcgcgcggccgaagtgttcggcttccacctc
gcgagcatcgacctgcgccagagctccgacattcacgaagcggtggtcgccgagctgttc
gcgcgcgcgggtgtcgtggccgactacgcgtcgctcgaagaggcggacaagctgcgcgtg
ctgctcgccgcgctggccgatccgcggccgctgcgctcgccgtacctcgaatactcggcg
ctcgcgcaaagcgagctcggcgtgttcgaaaaggcgcgcgaagtgcgggcgcagttcggc
gcgcgcgcggtgcgcaactacatcatttcgcacacggaaacggtcagcgatctcgtcgag
gtgctgctgctgcagaaggagaccggcctgctcgaaggcacgctcggcgcgccggacggc
cacgcgaagaacgcgctgatggtgatcccgctgttcgagacgattcccgacctgcgcgac
gcgtcgcggatcatgcgcgagtacttcgcgctgccgggcgtcgatgcgctgatccaccat
cagggcgacgagcaggaagtcatgctcggctactcggacagcaacaaggacggcggcttc
ctgacgtccaactgggagctgtatcgcgccgagctcgcgctcgtcgaactgttccgcgag
cgcaagatcacgctgcggctgttccacggccgcggcggcacggtcggccgcggcggcggc
ccgacctatcaggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctg
accgaacagggcgaagtgatcgcgagcaagttcgcgaaccccgagatcggccggcgcaac
ctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgccc
gcccagctgccggccttcgagggcgcgatgcagacgctgtccgacaccgcgatggccgcg
taccgcgcgctcgtctacgaaacgccgggcttcaccgattacttcttcgcgtcgacgccg
atcaccgaaatcgccgagctcaacatcggcagccgcccggcgtcgcgcaagctgcaggat
ccgaagaaccgcaggatcgaggatctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgctgctgaccggctggtacggcttcggcagcgcggtcgccgcgtatctggac
ggcgcggccgacgcagcggaacgcggcaagcggctcgcgttgctgaagaagatgaacaag
acctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgat
ctcgcggtcgcgtcgcgctacgccgaactcgtgccggaccgcaagctgcgcaacgcggtg
ttcgggcgcatcgtcgccgagtgggagcgcacgtcgcacgcgctcgcggagatcaccggg
cacgaggaacggctcgcgacgaatccgctgctcgcgcgctcgatcaagaaccgcttcccg
tatctcgatccgctgaatcacctgcaggtcgaactgatcaagcgccaccgcgccggcgac
acgaacgcgcggctgcgccgcgggattcatctgaccatcaacggcatcgcggccgggctg
cgcaatacgggctga

DBGET integrated database retrieval system