KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00365Help
Entry
BANAN_00365       CDS       T02047                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BANAN_00365
  Energy metabolism
   00680 Methane metabolism
    BANAN_00365
Enzymes [BR:bni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BANAN_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(77011..79767)
Genome map
AA seq 918 aa AA seqDB search
MTDQEQTITPADATIVTSGLGTKGPEERTLPATLQEDMDLCLNILREVLSEYDENLLKTF
DTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDAQLLARAFATYFHLANL
CEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPAKAKELLERLEFHPVFTA
HPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKENSRRLYNEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFHTIPMVYRRFDDWVLGDKAGIEPPACPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTPPSDELHTLWNQQKEISERLT
GKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCDDFLADLRVVQRSLAEAGDKRA
AYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDIREHGLHGERGPLQPMTHEVLDT
FRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELNRLAFSNPDDAPVIDVIPLFEQLE
DLENSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYSDSSKDAGPTTATLALHSAQERIAK
WADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPKGSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPMADQLSEVSHETFLDLLNSEDFAPWFS
IVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGSACESFG
DLATLRKAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDRPDLSKKVLDEMELTRKW
VLKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSESQLAGFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcaagagcaaacgatcacgccggccgatgccacgatcgtgacgtccgggctc
ggcaccaaaggtcccgaagagcgcacgcttcccgcgacattgcaggaagatatggacttg
tgtctgaacattctgcgcgaagtgctttccgaatacgacgagaatctcctcaaaacgttt
gacaccgtgcgtcaatatgccgtcgatgccagcgccgaacggttctccggcgtgctcacc
gacacccatcccgagcgcgatgatctcgaaatggccgtcaagacgatcgatgcgatgaat
ctgcacgacgcccagctgctcgcccgcgcgttcgccacgtacttccatctggcgaatctg
tgcgaggaaaactaccgtgtggccgtgctccatgagcgtgaggccaaggtggacgacact
caggccatcgatccggtgaacgagatgacgaaggcataccaccagctcatctccgaaatg
ggcccggccaaggccaaggagctgctcgaacgcctcgaattccacccggtgttcaccgcg
caccccaccgaggcgcgccgcaaggccgtggaaggcaagatccgccgcatcgcacagctg
ctcgaagcacaccgtctgctcggcggctccgacaagaaggagaacagccgtcgcctgtac
aacgagattgacgcactgttccgcacgtcgccgattgcgctgaagaagccgacgcctgtc
gaagaggccgacacgattctcgacatcttcgacaacacgctgttccacacgattccgatg
gtctaccgtcgtttcgatgactgggtgctcggcgacaaggccggcatcgagccgccggca
tgccccgcgttcttccacccgggcagctggatcggttccgaccgcgacggcaacccgaac
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccatgtgctcgccgcg
ctcgaggaggccacgcgtaccgtcggccgcaacatgaccgtcgaatccgagaccacgccg
ccgagcgatgagctgcacacgctgtggaaccagcagaaggagatcagcgagcgactcacc
ggcaaggcgtcgctcatctccacgaaggaactgcatcgtgcggtgctgctcgtcatggcc
gaccgcctgcattacacgatcaagcgcgacaccgatctcatgtaccacaactgcgacgac
ttcctcgcggatcttcgcgtggtgcaacgttcgctcgccgaggccggcgacaagcgcgcc
gcctacggcccgctgcaggacctcatctggcagaccgagaccttcggcttccacatggtc
gaaatggagttccgtcagcattcggtggtgcacgcgcgtgccctcgacgacattcgcgag
catggcctgcatggcgaacgtggaccgttgcagccgatgacacatgaggtgctcgacacc
ttccgtgccctcggcgcgattcagaagcgcaatggcgtcaaggccgcccgtcgctacatc
atctcgttcacgaagagcgcgaagaatgtgcgcgacgtgtacgagctcaaccgtctggcg
ttctcgaacccggacgacgccccggtgatcgacgtgatcccgctgttcgaacagctcgag
gatctcgagaactcggtctcggtgctcgacgagatgctgaagattcccgaggtgcaggcc
cgactcaagcagaccggccgcaagatggaggtcatgctcggctactcggattcatcgaag
gacgccggccccaccaccgccacgctcgcgctgcactccgcgcaggagcgcattgcgaag
tgggcggacgagaacgacatcgatctgacgctgttccacggccgcggcggcgccgtcggt
cgcggcggcggtccggccaaccgcgcggtgctcgcacagccgaagggttcagtcaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaatccggtgctc
gccatccgccacgtcgagtccgtggccgccgcgacgctgttgcagtcggctccgagcgtg
gagaagacgaacaccgagatgaccgagaaatacaagccgatggcggatcagctcagcgaa
gtttcacatgaaacgttccttgatctgctcaacagcgaggacttcgcaccgtggttctcg
atcgtcacgccgctgaccgagatcggcttgctgccgatcggttcccgccctgcgaagcgc
ggcttgggagccaagtcgctcgacgatctgcgtacgattccatggatcttctcgtgggcc
caggcccgcatcaacctcgccgcctggtatggcctcggctccgcatgcgagtcgttcggc
gacctcgccacgctgcgcaaggcatacgaggaatggccgctgttctccaccttcatcgac
aacatcgagatgtcactggcgaagaccgacgaacgcatcgcgaagatgtaccttgcactc
ggcgaccgcccggacctctcgaagaaggtgctcgacgagatggagctcacacgcaagtgg
gtgctcaagatcgtgggcgacgaatggcctctgcagcaccgtcatgtgcttggccaggcg
attcgcatccgctccccgtacgtcgacgcactgtctgtcacgcaggtgctcgcattgcgt
tcgctgcgtaagaaggtcgacaaggaggagctctccgaaagccagctggcaggattcatc
tacctgattctgtgcaccgtttcgggtgtcgccgccggcctgcagaacaccggctga

DBGET integrated database retrieval system