KEGG   Burkholderia oklahomensis E0147: DM82_444Help
Entry
DM82_444          CDS       T03284                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bok00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM82_444
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DM82_444
   00680 Methane metabolism
    DM82_444
Enzymes [BR:bok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DM82_444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(521730..524588)
Genome map
AA seq 952 aa AA seqDB search
MNAARPASAAPAKPHGRTREDKDRPLFEDIRYLGRLLGDVVREQEGDDVFHVVETIRQTA
VKFRREDDSAAAQTLEKMLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAG
SAPQAGTVAYALDKLKEAGDASPKVIKRFFEGALIVPVLTAHPTEVQRKSILDAQHDIAH
LLAERDQPLTAREFAHNEALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDEL
PALYADIEEALAEHGLPARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVIFEHY
LEQVHKLGAELSVSNLLVGANDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARV
RLGEGAVPVRSAGRGAAPVRATPYADAEEFAADLRVLTDSLALHHGESLATPRLAPLMRA
AEVFGFHLASIDLRQSSDIHEAVIAELLARGGVEPDYAALAEADKLRVLLAALADPRPLR
SPYLDYSDLAKSELGVLERAHAIRAQFGPRAVRNYIISHTETVSDLVEVLLLQKETGLFE
GTLGTPHANARNGLMAIPLFETIADLRNAPDIMREFFALPGVGELVAHQGHEQEVMLGYS
DSNKDGGFLTSNWELYRAELALVDLFSERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPG
TVNGQIRLTEQGEVIASKFANPEIGRRNLETVVAATLEATLLPHRNAPKQLPAFEAAMQA
LSDAAMASYRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAI
PWGFSWGQCRLLLTGWYGFGSAVAAFLDGTKDVAERAKRVALLKKMNKTWPFFAHLLSNM
DMVLAKTDLAVASRYAQLVADKKLRKHVFERIVSEWHRTSDALAEITGSDARLAANPLLA
RSIKNRFPYLDPLNHLQVELIKRHRSGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcggcccggccggcgagcgccgcgccggccaaaccgcacggccgcacgcgcgag
gacaaggaccgcccgctcttcgaagacatccgctatctcggccgcctgctcggcgacgtc
gtccgcgagcaggaaggcgacgacgtgtttcacgtcgtcgagacgatccgccagaccgcc
gtcaagttccgccgcgaggacgacagcgccgccgcgcagacgctcgagaagatgctgcgc
aagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcgcatctc
gcgaacatcgccgaggaccgccatcacaaccgccgccgccggatccacgcgctcgcgggc
tccgcgccgcaggcgggcaccgtcgcgtacgcgctcgacaagctgaaggaagcgggcgac
gcgtcgccgaaggtgatcaagcggttcttcgaaggcgcgctcatcgtgcccgtgctgacc
gcgcacccgaccgaggtgcagcgcaagagcattctcgacgcgcagcacgacatcgcgcat
ctgctggccgagcgcgaccagccgctgaccgcgcgcgagttcgcgcacaacgaggcgctc
ttgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgcttgacg
gtcgccgacgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgacgagctg
cccgcgctctacgcggacatcgaggaagcgctcgccgagcacggcctgcccgcgcgcgtg
cccgcgttcttccagatgggaagctggatcggcggcgaccgcgacggcaacccgaacgtc
acggccgcgacgctcgacgaagcgatcaaccgccaggccgcggtgatcttcgagcattac
ctcgagcaggtgcacaagctcggcgccgagctctccgtgtcgaacctgctcgtcggggcg
aacgacgcgctgaaggcgctcgcggccgcgtcgccggaccagtcgccgcaccgcgtcgac
gagccgtatcggcgcgcgctgatcggcgtctacacgcggcttgcggcgagcgcgcgcgtg
cggctcggcgaaggcgcggtgcccgtgcgcagcgcgggccgcggcgccgcgcccgtgcgc
gcgacgccgtatgcggacgccgaggaattcgccgccgatctgcgcgtgctgacggattcg
ctcgcgctgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatgcgcgcg
gccgaggtgttcggcttccatctcgcgagcatcgacttgcggcaaagctcggacatccac
gaagcggtgatcgccgagctgctcgcgcgcggcggcgtcgagcccgactacgcggcgctc
gccgaagcggacaagctgcgcgtgctgctcgcggcgctcgccgatccgcggccgctgcgc
tcgccgtatctcgactactcggatctcgcgaaaagcgagctcggcgtgctcgagcgcgcg
cacgcgatccgcgcgcagttcggtccgcgcgcggtgcgcaactacatcatctcgcacacc
gagacggtgagcgatctcgtcgaggtgctgctgctgcagaaggaaacaggcctcttcgaa
ggcacgctcggcacgccgcacgcgaacgcgcgcaacggcctgatggcgatcccgctcttc
gagacgatcgccgacctgcgcaacgcgcccgacatcatgcgcgagttcttcgcgctgccg
ggcgtcggcgagctggtcgcgcaccagggccacgaacaggaagtgatgctcggctattcg
gacagcaacaaggacggcggctttctcacgtcgaactgggagctctatcgtgcggaactg
gcgctcgtcgatctgttcagcgagcgcgggatcaagctgcgcctcttccacggccgcggc
ggcacggtcggccgcggcggcggcccgacctaccaggcgatcctgtcgcagccgcccggc
acggtgaacggccagatccgcctgaccgagcagggcgaagtgatcgcgagcaagttcgcg
aacccggagatcggccggcgcaacctcgagacggtcgtcgccgcgacgctcgaggcgacg
ctcctgccgcaccgcaacgcgccgaagcagttgcccgcgttcgaggcggcgatgcaggcg
ctgtccgacgccgcgatggcctcgtaccgcgcgctcgtctacgagacgcccggcttcacc
gactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggcagccgg
ccggcgtcgcgcaagctgcaggatccgaagaaccgcaagatcgaggacctgcgcgcgatt
ccgtggggcttctcgtggggccagtgccggctgctgctgacgggctggtacggcttcggc
agcgcggtcgccgcatttctcgacggcacgaaggacgtcgccgagcgcgcgaagcgagtc
gcgctgctgaagaagatgaacaagacctggccgttcttcgcgcacctgctgtcgaacatg
gacatggtgcttgcgaagacggatctcgcggtcgcgtcgcgctacgcgcagctcgtcgcc
gacaagaagctgcgcaagcacgtgttcgagcggatcgtctccgaatggcaccgcacgtcg
gacgcgctcgccgagatcaccggcagcgacgcgcggctcgccgcgaatccgctcctcgcg
cgctcgatcaagaaccgcttcccatatctcgatccgctcaaccacctgcaggtcgagctg
atcaagcggcaccgctccggcgacacgaacgcgcgcctgcggcgcgggatccatttgacg
atcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system