KEGG   Burkholderia oklahomensis E0147: DM82_4887Help
Entry
DM82_4887         CDS       T03284                                 

Definition
(GenBank) acyltransferase family protein
Organism
bok  Burkholderia oklahomensis E0147
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1370290..1373133
Genome map
AA seq 947 aa AA seqDB search
MEHTHRLSDNATRLLALLDALLAELYGERNGHRHATLDAQFERDLGFDSLTRAELFDRIE
RAFGVRLPVDVFASAATPADVVRALADAHARAQPHAAAGDEAVSMSPADAAAWPVDVDTL
IDALRWHAERHPDRVHLRLLEDGLTATPLTYGELYRRASDMASGLRERGIDPGDTVALML
PTGLDYFVSFAAILFCGAIPVPIYPPANLAQLDEHVGRHTPILENARIKALIAFRPAVSI
AQLLKLRVSTLQHVLTPEQIAGRAHLPPFRAAADDVALLQYTSGSTGTPKGVMLSHANLL
ANIRAMGDRMRVDASDVLVSWLPLYHDMGLIGAWLAPLYFGIPAIVMSPVVFLARPALWL
RAISRYRGTITAAPNFAYERCARHLAALEPTEFDLSSLRFAFCGAEPVNPDTLRAFAARF
ASCGFDARALTPVYGLAENTLGLTFPAPALGLRVDRVAREPLSASGRATPAPGDANALDV
PSCGYPLDGTELRIVDDGEREVAERQVGRIEFRGTSATRGYYRNPAQTARLFHDSWRDTG
DLGYVADGELYITGRAKDMIIRGGQHFFPYELEEAIERLPGAVTGGVAVCGGADPVSGTE
RVVILVESDATDDAVCERLRASVNDVTAALWGMPAEQVSIVAPHGILKTPSGKIRHAATL
EKFERHAGRLPQAPASWRQFADLAAGSVAPFGRRASRRAAHVLRGLYCWALAALLAPALW
ALVAYRKDPQDNWPLAAYACHTFLRLAGVRTNLIADPDALAAGPSIVVANHTSYMDVVAL
LALLPQPVHFVAKRELATRPFVGRFLRALGTRFVERREYSRSIEDEARLVAQAAADDTLL
FFPEGTFTRAAGLGAFRLGAFRAACVARRPVVPVVVSGARAVLRDGEWLPRRGEITVTML
APIRPDGADFGAMARLRDRARGAILAHCGEPDLRDGGAQRVEFAPAA
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacgcaccgcctatccgacaacgcaacgcgattgctcgcgctgctcgacgcg
ttgctcgccgagctgtacggcgagcggaacggccatcgccacgcgacgctcgatgcgcag
ttcgagcgcgatctcggcttcgacagcctgacgcgcgcggagttgttcgaccggatcgag
cgtgcgttcggcgtgcgcttgccggtcgacgtgttcgcgtccgccgcgacgcccgcggac
gtcgtgcgcgcgctggccgacgcacacgcacgcgcgcaaccgcacgccgctgccggcgac
gaagccgtgtcgatgtcgcccgccgacgccgccgcgtggcccgtcgacgtcgacacgctg
atcgacgcgttgcgctggcatgccgagcgtcatccggatcgcgtccatctgcgattgctc
gaagacggcctgacggcgacgccgctcacgtatggcgagctgtatcggcgcgcgtcggac
atggcgagcggcctgcgcgagcgcggcatcgatccgggcgacacggtcgcgctgatgttg
ccgacggggctcgactacttcgtgtcgttcgccgcgattctgttctgcggcgcgattccg
gtgccgatctatccgcccgccaatctcgcgcagctcgacgagcacgtcgggcgccacacg
ccgatcctcgaaaatgcgcggatcaaggcgctgatcgcgtttcgcccggccgtctcgatc
gcgcagctgctgaagctgcgcgtgagcacgctgcagcacgtgctcacgcccgagcagatc
gcgggccgcgcgcatctgccgccgtttcgcgcggcggccgacgacgtcgctttgcttcag
tacacgtcgggcagcaccggcacgccgaagggcgtgatgctcagtcatgcgaatctgctc
gcgaacatccgcgcgatgggcgaccggatgcgcgtcgacgcgtccgacgtgctcgtgagc
tggctgccgctgtatcacgacatgggactgatcggcgcgtggctcgcgccgctttatttc
ggcatcccggcgatcgtgatgtcgcccgtcgtgttcctcgcgcggccggcgctctggctg
cgcgcgatctcgcggtatcgcggcacgatcaccgccgcgccgaacttcgcgtacgagcgc
tgcgcgcgccatctcgccgcgctcgaaccgaccgaattcgatctgtcgtcgctgcgcttc
gcgttctgcggcgcggagcccgtcaatccggacacgctgcgcgcgttcgccgcgcgcttc
gcgtcgtgcggcttcgacgcgcgcgcgctgacgcccgtctacgggctcgcggaaaacacg
ctcgggttgacgtttccggcccccgcgctgggactgcgggtcgatcgcgtcgcgcgcgag
ccgctcagcgcgagcggccgcgcgacgcccgcgcccggcgacgcgaacgcgctcgacgtg
ccgagctgcggctatccgctcgacggcaccgagctgcggatcgtcgacgacggcgagcgc
gaggtcgccgagcggcaggtcgggcgcatcgagtttcgcggcacgtcggcgacgcgcggc
tattaccgcaatcccgcgcagaccgcgcgcctgttccacgatagctggcgcgacaccggc
gatctcggctacgtcgccgacggcgagctgtacatcaccggacgcgcgaaggacatgatc
atccgcggcggccagcatttctttccatacgagctggaggaggcgatcgaacggctgccg
ggcgccgtgacgggcggcgtcgcggtgtgcggcggtgccgatccggtgagcggaaccgag
cgggtcgtgattctcgtcgagagcgacgcaaccgatgatgccgtgtgcgagcgtctgcgc
gcgagcgtcaacgacgtgacggccgcgctctggggcatgccggccgagcaggtgagcatc
gtcgcgccgcacggcatcctgaagacgccgagcggcaagattcgccacgcggcgacgctc
gagaagttcgagcgccacgccggacggctgccgcaggcgcccgcgtcgtggcggcagttc
gccgacctggcggccggcagcgtcgcgccgttcggccggcgcgcgtcgcggcgcgcggcg
cacgtgctccgggggctgtactgctgggcgctcgcggcgctgctcgcgcccgcgctgtgg
gcgctcgtcgcgtaccggaaggatcctcaggacaactggcctctcgcggcatacgcgtgc
cacacgttcctgcgtctcgccggcgtgcgcacgaacctgatcgccgatcccgacgcgctt
gcggccgggccgtcgatcgtcgtcgcgaatcatacgagctatatggacgtcgttgcgctg
ctcgcgctgctgccgcaaccggtgcacttcgtcgcgaagcgcgaactcgcgacgcgaccg
ttcgtcggccgcttcctgcgcgcgctcggcacgcggttcgtcgaacggcgcgagtacagc
cgcagcatcgaggacgaggcgcggctcgtcgcgcaggcggccgccgacgatacgctgctg
ttcttcccggaaggcacgttcacgcgcgcggcggggctcggcgcgttccgcctcggcgcg
tttcgcgcggcgtgcgtcgcgcggcggccggtggtgcccgtcgtggtgagcggcgcgcgc
gccgtgttgcgcgacggcgaatggctgccgcgccgcggggagatcaccgtgacgatgctc
gcgccgatccggcccgacggcgcggacttcggcgcgatggcgcggctgcgcgaccgcgcg
cgcggcgcgattctcgcgcattgcggcgagccggacttgcgcgacggcggcgctcagcgc
gtggagttcgcgccggccgcgtaa

DBGET integrated database retrieval system