KEGG   Bos mutus (wild yak): 102266786Help
Entry
102266786         CDS       T02919                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bom  Bos mutus (wild yak)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:bom00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    102266786
   04614 Renin-angiotensin system
    102266786
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    102266786
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    102266786
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102266786
Peptidases [BR:bom01002]
 Metallo Peptidases
  Family M2
   102266786
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102266786
CD molecules [BR:bom04090]
 Proteins
  102266786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 743 aa AA seqDB search
MGHGWAAPGLPRLLLLLLCCGRPLLVPSEGTTGQGTTSQVTVNQETTSQATTSSETTIRH
STTHPSTISSPKKTQSPNLVSDEDEARKFVEEYDRRSQVVWNEYAEANWNYSTDISTDNS
KLLMEKNLQMANHTVKYGTWARKFDVTNFQNATMKRMIKKIQDLERAALPTKELEEYNQI
LLDMETVYSVASVCHENGTCLRLEPDLTNLMATSRNYQHLAWAWKSWRDKVGRSILPYFP
KYVELTNKAARLNGYQDGGDSWRSMYEMPFLEEELEQLFQELQPLYLNLHAYVRRALHRH
YGPDVINLEGPIPAHLLGNMWAQSWSNIYDLVAPFPSAPKMDATEAMIKQGWTPLRMFKE
ADNFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHASAWDFFNGKDFRIKQCTSVNMEDL
VVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVSTPTHLHKINLLSSGDG
GYEEDINFLMKMALEKIAFIPFSFLVDQWRWRVFDGSVTRENYNQEWWSLRLKYQGVCPP
LARSQDDFDPGAKFHIPASVPYVRYFVSFVIQFQFHQALCQAAGHQGPLHKCDIYQSKEA
GKLLADAMKLGFSQPWPEAMRLITGQSNMSAAAMMTYFKPLLDWLVTENGRHGEKLGWPQ
YNWTPNSARLEGPFVGSGRVNFLGLNLEEQQARVGQWVLLFLGVALLVATLGLTQRLFSI
RHHSLRRPHRGPQFGSEVELRHS
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgggccatggttgggctgctccaggactgcctcgcctcctcctcctcctgctctgctgt
gggcgccccctgctggtccccagtgaggggaccaccggccaggggaccaccagccaggtg
acagtcaaccaggaaacaaccagccaggcaacaaccagcagtgagacaaccatccgccac
tcaaccacccatccctcaacaatcagcagcccgaagaaaacccagagcccaaacctggtg
tccgacgaggacgaggcccgcaagtttgtggaggaatacgaccggagatcccaggtcgtg
tggaacgagtatgccgaggccaactggaactacagcaccgacatcagcacggacaacagc
aagttgctgatggagaagaacttacagatggcaaaccacaccgtcaagtatggcacctgg
gccaggaagtttgacgtgaccaacttccagaatgccaccatgaagcggatgataaagaag
attcaggatctagagcgggcagcactgcccaccaaggagctggaagagtataaccagatc
ctgctggacatggagaccgtttacagcgtggcctctgtgtgccatgaaaatggcacctgc
ctgcggctcgagcctgatctgaccaatctgatggccacatcccggaattatcagcacctg
gcctgggcgtggaagagctggcgtgataaagtggggcggtccatcctcccctatttcccc
aaatacgtggagctcaccaacaaggccgccaggctcaatggctaccaggatggcggggac
tcctggaggtccatgtacgagatgcccttcctagaggaggagctggagcagctgttccaa
gagctgcagccgctctacctgaacctgcacgcctacgtgcgccgggccctgcaccgccac
tacgggcccgacgtcatcaacctggagggccccatcccagcccacctgctcgggaacatg
tgggcacagagctggtccaacatctatgacttggtggcacccttcccttcagcccccaag
atggatgccacggaggccatgataaagcagggctggacacccctaaggatgtttaaggaa
gcagacaatttcttcacctccctggggctgctgcccatgccccctgaattctggaacaag
tcgatgctggagaagccgaccgatgggcgggaagtggtgtgccacgcctccgcctgggat
ttcttcaacggcaaggactttaggatcaagcagtgcacctcggtgaacatggaggacctg
gtggtggcccaccacgaaatgggccacatacagtacttcatgcagtacaaggacttgccc
gtgaccttccgggagggtgccaaccccggctttcacgaggccattggggacgtgctggcc
ctctcagtgtccacccccacgcacctgcacaagataaacctgctgagcagtggggacggc
ggctacgaggaggatatcaactttctgatgaagatggcgctcgagaagatcgccttcatc
cccttcagcttcctcgtcgaccagtggcgctggagggtgttcgatggaagtgtcaccagg
gagaactacaaccaggagtggtggagcctcaggctgaagtaccagggtgtctgtccccca
ctggccagatctcaagatgactttgacccaggggccaagttccacattcctgcaagtgtg
ccttacgtcaggtacttcgtcagctttgtcatccagttccagttccaccaggcgctgtgt
caggcagcgggccaccagggccccctgcacaagtgtgacatctaccagtctaaggaggcc
gggaagctcctggcggatgccatgaagctgggcttcagtcagccgtggcccgaagccatg
cggctgatcacgggccagtccaacatgtcggctgccgccatgatgacctacttcaagccg
ctgctggactggctcgtgacggagaacgggcggcacggggagaagctgggctggcctcag
tacaactggacgccaaactcggctcgcctggaaggccccttcgtgggctccggccgcgtc
aacttcctgggcctgaacctggaggagcagcaggcccgcgtgggccagtgggtgctgctc
ttcctgggcgtcgccctgctggtggccacgctgggcctcacccagcggctcttcagcatc
cgccaccacagcctccgccggccccaccgtgggcctcagtttggctccgaggtggagctg
agacactcctga

DBGET integrated database retrieval system