Bos mutus (wild yak): 102267219 Help Entry 102267219         CDS       T02919                                  Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism bom  Bos mutus (wild yak) Pathway bom04072   Phospholipase D signaling pathway bom04140   Autophagy - animal bom04150   mTOR signaling pathway bom04151   PI3K-Akt signaling pathway bom04152   AMPK signaling pathway bom04211   Longevity regulating pathway bom04218   Cellular senescence bom04714   Thermogenesis bom04910   Insulin signaling pathway bom04919   Thyroid hormone signaling pathway bom05163   Human cytomegalovirus infection bom05165   Human papillomavirus infection bom05168   Herpes simplex virus 1 infection bom05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     102267219    04151 PI3K-Akt signaling pathway     102267219    04152 AMPK signaling pathway     102267219    04150 mTOR signaling pathway     102267219  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102267219   09143 Cell growth and death    04218 Cellular senescence     102267219  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102267219    04919 Thyroid hormone signaling pathway     102267219   09149 Aging    04211 Longevity regulating pathway     102267219   09159 Environmental adaptation    04714 Thermogenesis     102267219  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     102267219   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102267219    05163 Human cytomegalovirus infection     102267219    05165 Human papillomavirus infection     102267219  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bom04031]     102267219 GTP-binding proteins [BR:bom04031]  Small (monomeric) G-proteins   Ras Family    Rheb     102267219 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 Motif Other DBs NCBI-GeneID:  102267219 NCBI-ProteinID:  XP_005894611 LinkDB All DBs Position Un AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQYVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgttgacgattcagtatgttgaaggccaatttgttgactcctacgatccaaccatagaa aatactttcacaaaattgatcacagtaaatggacaggagtatcatcttcaacttgtggac acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggc tatattcttgtgtattctgttacatcaatcaaaagctttgaagtgatcaaagttatccat ggcaaattgttggatatggtggggaaagtacagatacctattatgttggttgggaataag aaagacctacatatggaaagggtgattagttatgaagaagggaaagcgttagcagagtct tggaacgcagcgtttttggaatcatctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc tgctcggtgatgtga

DBGET integrated database retrieval system