Bos mutus (wild yak): 102285770 Help Entry 102285770         CDS       T02919                                  Name (RefSeq) uncharacterized LOC102285770   KO K02272   cytochrome c oxidase subunit 7c Organism bom  Bos mutus (wild yak) Pathway bom00190   Oxidative phosphorylation bom01100   Metabolic pathways bom04260   Cardiac muscle contraction bom04714   Thermogenesis bom04932   Non-alcoholic fatty liver disease bom05010   Alzheimer disease bom05012   Parkinson disease bom05014   Amyotrophic lateral sclerosis bom05016   Huntington disease bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05208   Chemical carcinogenesis - reactive oxygen species bom05415   Diabetic cardiomyopathy Module bom_M00154   Cytochrome c oxidase Brite KEGG Orthology (KO) [BR:bom00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     102285770  09150 Organismal Systems   09153 Circulatory system    04260 Cardiac muscle contraction     102285770   09159 Environmental adaptation    04714 Thermogenesis     102285770  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102285770   09164 Neurodegenerative disease    05010 Alzheimer disease     102285770    05012 Parkinson disease     102285770    05014 Amyotrophic lateral sclerosis     102285770    05016 Huntington disease     102285770    05020 Prion disease     102285770    05022 Pathways of neurodegeneration - multiple diseases     102285770   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     102285770   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102285770 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  COX7C Motif Other DBs NCBI-GeneID:  102285770 NCBI-ProteinID:  XP_014335802 LinkDB All DBs Position Un AA seq 171 aa AA seqDB search MVERVMKYTNDYQHQYDKVCSLSPSARFSHDISRPARSPPSPPPRGEPRPWHLQAARSGA AAAPRRLRSDTVSPGTQPSRRSREKQVQELRQQPRQVPRGSSRVSNSARLGQSIRRFTTS VVRRSHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atggtagagagggtgatgaagtacacaaatgactatcagcaccagtatgacaaagtgtgc tcgctcagtccgtctgcacgcttctcacatgacatcagccggcccgcccgctccccgccc agcccgccaccgcgcggggaacctcggccctggcacctccaggcggcccggtccggggca gccgcggccccgcggcgcctccgcagcgatacggtctcccctggaacgcaaccatcccgc aggtcccgggagaaacaagtgcaggagctacgccagcagccccgccaggtcccccgcggc tcttccagagtgtccaacagtgctaggctgggacagagcatccggaggttcacaacctca gtggttcgtcggagccactatgaggagggtccagggaagaatataccattttcagtggaa aacaagtggagattactagctatgatgactttgttctttgggtctggatttgctgcacct ttctttatagtaagacaccaactgcttaaaaagtaa

DBGET integrated database retrieval system