KEGG   Bacillus oceanisediminis: A361_26010Help
Entry
A361_26010        CDS       T04330                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00240  Pyrimidine metabolism
bon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bon00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A361_26010
Enzymes [BR:bon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A361_26010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_19 AAA_14
Motif
Other DBs
NCBI-ProteinID: AND42464
UniProt: A0A160MHB0
LinkDB All DBs
Position
complement(5211316..5211936)
Genome map
AA seq 206 aa AA seqDB search
MYVMNHHGWVEVICGSMFSGKSEELIRRVRRAQFAKQQIAVFKPQIDNRYSDEAVVSHNG
TSVIARPISQSTDIFKYITADIDLIAIDEVQFFDDEIVKVIQHLADSGHRVIAAGLDQDF
RGEPFGQMPAIMSIAELVTKLQAVCAVCGSPASRTQRLINGKPASYDDPVILVGASEAYE
PRCRHHHEVPKSPNVLDKHKTTEFLS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttatgaatcatcacggatgggtggaagtcatttgcggcagcatgttttccggc
aaatcagaagaactgattcgccgtgtgcgcagagctcaattcgccaagcagcaaatcgct
gtatttaagccgcagatcgataaccgatacagtgatgaagctgtcgtttcacataatgga
acttcggtcatagctagacccatttcccagtctaccgatatttttaaatacattacagct
gacattgatttgattgcgattgatgaagtgcaattttttgatgatgaaattgtaaaagtc
attcagcacctggctgacagcggacatcgtgtcatcgcggctggacttgaccaggacttc
cgcggggagccgtttggccaaatgcctgccatcatgtcgatagcagaattggttacaaag
cttcaagccgtctgtgccgtttgcggttcacctgcaagccgtacacagcgcctgatcaat
ggaaagccagcttcatatgatgacccggttattttggtcggcgcatcagaagcatatgaa
ccgcgctgccgccatcaccatgaagttcccaagtcgccaaatgttctagacaaacataaa
acaaccgagtttttatcataa

DBGET integrated database retrieval system