KEGG   Bosea sp. RAC05: BSY19_991Help
Entry
BSY19_991         CDS       T04462                                 

Definition
(GenBank) ribulose bisphosphate carboxylase large chain, catalytic domain protein
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bos  Bosea sp. RAC05
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bos00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSY19_991
Enzymes [BR:bos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BSY19_991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1059147..1060406
Genome map
AA seq 419 aa AA seqDB search
MLTDRFEADYLLETPLDPARAAETMAGEQSSGTFVAIPGETPELKARASARVVALEILER
DVPGRSLPSNVASAPGERITRARVTLSWPLANIGPSLPNLLATVAGNLFELKCASGLRIL
DIRLPAAFGEAYPGPRFGIAGTRRLAGVEGRPLIGTIIKPSVGLDAAATAALVDELCGAG
IDFIKDDELQSDGPACPFDQRVAAVMAVIERHADRTGRKPMFAFNLTGDLDQMRRRHDTL
LAHGATCLMASLNSVGLVGMIELGRFAQLPIHAHRNGWGYLSRHPMLGWSYVAWQKLWRL
AGADHMHVNGLSNKFSETDDSVIASARECLTPMFADKPCTVMPVFSSGQTVRQAHGTYAA
LGSTDLLMTAGGGVMAHPNGVAAGVRSLREAWAAAIAGIPLAEHALTHPELGRALEIAA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagaccgcttcgaggccgactatctgctggagacaccgctcgaccccgcgcgc
gccgccgagaccatggcgggcgagcagtcgagcggcaccttcgtggccattcccggcgag
acgccggagctgaaggcgcgcgcctctgcacgggtggtggcgctcgagatcctggagcgc
gacgttccgggccgctctctgccctccaatgtcgcgagcgcccccggcgagcgcatcacc
cgggctcgcgtcaccctgtcctggccgctggcgaatatcggcccgtccctgcccaacctg
ctcgccaccgtcgccggaaacctgttcgagctgaaatgcgccagcggtctgcggatcctc
gacatccgcctgccggcagccttcggcgaggcctatcccgggccgcgtttcggcatcgcc
ggcacgcgtcgcctcgctggcgtggaggggcgcccgctgatcggcaccatcatcaagccg
agcgtcgggctcgatgcggccgcgaccgccgcgctcgtcgacgagctctgcggcgccggc
atcgacttcatcaaggacgatgaattgcagtcggacgggccggcctgtcccttcgaccag
cgcgtcgccgcggtgatggcggtgatcgagcgccatgccgaccgcaccggccgcaagcca
atgttcgccttcaatctgaccggcgatctcgaccagatgcgccgccgccacgacaccctg
ctcgcccatggcgccacctgcctgatggcgagcctgaactcggtcggcctcgtcgggatg
atcgagctcgggcgcttcgcgcaactgccgatccacgcccatcgcaatggctggggctat
ctctcgcgccacccgatgctgggctggtcctatgtcgcctggcagaagctctggcgcctg
gcgggggccgaccacatgcatgtcaacgggctctccaacaagttctcggagaccgacgac
agcgtcatcgcctcggcgcgcgaatgcctgacgccgatgttcgccgacaagccctgcacg
gtcatgccggtgttctcctcgggccagacggtgcggcaggcgcacggcacctatgccgcg
ctcggcagcaccgacctgctcatgacggccggtggcggcgtgatggcccatcccaacggg
gtcgcggcgggggtgcgctcgctgcgcgaggcctgggcggcggcgatcgccggaatcccg
ctggccgagcacgcccttacgcatcctgaactcggccgggcgctggagatcgcggcgtga

DBGET integrated database retrieval system