KEGG   Brucella ovis: BOV_0192Help
Entry
BOV_0192          CDS       T00534                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bov  Brucella ovis
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BOV_0192 (glpD)
Enzymes [BR:bov01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BOV_0192 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:210953..212497
Genome map
AA seq 514 aa AA seqDB search
MVFAGRFSGYAMVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRAT
KLIHGGLRYLEHYEFRLVREALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWLLRLGL
FLYDHLGGRKKLPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTARDAADR
GAKIATRTSVVAASRDGQGWTITLEDTGTGRRENVHARLLVNAAGPWADKVLQGVEGDRQ
LHNIRLVQGSHIVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKV
AITDSETDYLCQAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPD
GLAPLINVFGGKLTTARKLAEHMLQKIEHRLGRKGAPWTHAAPLPGGDFEDVAFETELKK
LEAAYPFLDARHARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAEVRYFVENEWAR
SAEDILWRRTKLGLRLTAAEVAAVQGFVEPAIAA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttggtgttcgcaggccggttttcgggatacgccatggtgcaggaaaaacaattcgatatt
tttattataggtggcggcatcaatggctgcggcattgcccgtgatgcggtggggcggggc
ttcaccgttgggctggccgagatgaacgatctggcaagcggcacctcttcgcgcgcaacc
aagctcattcacggtggtttgcgctatctggaacattatgaattccggctggtgcgcgag
gcgctgatggagcgcgaggtgctgtgggccaatgcgccgcatatcatccatccgatgcgt
ttcgtgctgccttatcataagggcggcctacgtcccgcctggctgttgcggcttggcctg
tttctttacgaccatctgggcggccgcaagaagcttcccgccacgcgcacgctcaacatg
cgcaccgacaaggccggcgaaccgctgaaaccgcttttcaccaaggcttttgaatattcc
gattgctgggtggacgatgcgcgcttcgtggcgctcaccgcccgcgatgcggctgatcgc
ggcgcgaagatcgcgacccgaacgagcgtcgttgccgcaagccgcgacgggcagggctgg
accatcacactggaagataccggcaccggcaggcgtgagaacgtacacgcccgccttctg
gtcaatgccgccgggccgtgggccgacaaggttctgcaaggtgtggaaggcgaccggcaa
ttgcacaatatccgtctggtgcagggcagccatatcgtcgtgcgcaggaagttttccgac
ccgcgcgcctatttcttccagaacaacgacgggcgcatcatcttcgccattccttatgaa
gatgatttcaccctgattggcaccacggatcaggattataagggcgacccggccaaggtg
gcgatcaccgacagcgagaccgattatctctgccaggcggcaagcgaatatttccgcgag
ccggtgcgccgggaggatatcgtctggacctattccggcgtgcgcccgctctatgatgac
ggggccagcaaggcgcaggaggcaacccgcgactatgtgctgaaggaagatgcgccagat
ggtctggcgccgctcatcaatgttttcggcggcaagctcaccacagcacgcaagcttgcc
gaacatatgctgcagaaaatcgagcaccggcttggccgcaagggcgccccatggacccat
gcagcaccattgccaggcggggatttcgaggatgtggcttttgaaacggaactgaagaag
cttgaggcagcctatcctttccttgatgcgcgccatgcgcgccgcctgttccggctctat
ggcacccgggcatataagcttttggggcaggcttcttcgctgggcgatcttggccgtcat
tttggcagcgatctctatgaggcggaagtgcgctattttgtcgaaaatgaatgggcgcga
agcgcggaagacattttgtggcggcgcaccaagctcggcctgcgcctgacggcggcggaa
gtcgcggccgtgcagggctttgtggagcctgcaatcgccgcctaa

DBGET integrated database retrieval system