KEGG   Bordetella parapertussis Bpp5: BN117_1892Help
Entry
BN117_1892        CDS       T02297                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bpar  Bordetella parapertussis Bpp5
Brite
Enzymes [BR:bpar01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BN117_1892 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2067879..2068457
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYALDALAPRISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS
SGGVFNNAAQVWNHTFYWNSLSPNGGGEPSGALADAIKAKWGSVDAFKEAFNKSAAGNFG
SGWTWLVKKADGTLDIVNTSNAATPLTTADKALLTCDVWEHAYYIDYRNARPKYLENFWA
LVNWEFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcacacactcttccccccctgccttacgctctggatgcgctggctccgcgcatttcc
aaggaaacgctcgagtttcactacggcaagcaccaccagacgtacgtcaccaacctgaac
aacctgatccccggcacggagttcgagaacctgtcgctggaagagatcgtcaagaagtcc
tcgggtggcgttttcaacaatgccgcccaagtctggaaccacacgttctactggaacagc
ctgtcgcccaacggcggcggcgagccctccggcgcgctggccgatgccatcaaggccaag
tggggcagcgtggacgccttcaaggaagccttcaacaagtcggccgccggcaacttcggc
tcgggctggacctggctggtcaagaaggccgacggtacgctggacatcgtcaacaccagc
aacgccgccacgccgctgacgaccgccgacaaggcgctgctgacctgtgacgtgtgggag
cacgcgtactacatcgattaccgcaatgcccgtcccaagtacctggaaaatttctgggcg
ctggtgaactgggaattcgccgcgaagaatttcgcctaa

DBGET integrated database retrieval system