KEGG   Bordetella pseudohinzii: BBN53_11120Help
Entry
BBN53_11120       CDS       T04945                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpdz  Bordetella pseudohinzii
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBN53_11120
Enzymes [BR:bpdz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBN53_11120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2433960..2435567
Genome map
AA seq 535 aa AA seqDB search
MNPSTSDAMPSRAELLARLETSDPWDVIIIGGGATGLGTAVDAASRGFRTLLIEGADFAK
GTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLAWPLGFVVPAYSLLDQPF
YGVGLKVYDMLAGALNLAPSRWLSRDETLTHARTLAPEIKGKRLRGGVLYYDGQFDDARL
AVSLMRTLFDQGGTAINYVRVTGLSRDAQGRVDGVQTEDAIDGARHAIRGKCIVNATGVW
VDAVRRMDDPAAQTMVAPSQGVHLTLPRDFLPGDEAILVPKTDDGRVLFMVPWNGHTIVG
TTDTARQDLPADPRPLPGEVEFILETAARYLTRKPTRADVTSVWAGLRPLVKATGEASTK
SLSREHTILVSKSGLITVTGGKWTTYRKMAQDVVDTAIENQLLPQAACRSADLRLHGAPA
PGARLAAPQGTPDSYYGTDLPALRALPGADRMLVKASGLTEAHVRYAARHELARTVEDVL
ARRNRALFLDAEAAQLAAPEVARLLAQELGHDAAWQQRTLADFEAVAATFRLPPA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaagcacttccgacgccatgccctcgcgcgcagaacttctcgcccgcctggag
acctccgacccctgggacgtgatcatcatcggcggcggcgccaccggcctgggcaccgcc
gtggacgcggcgtcgcgcggctttcgcaccttgctcatcgagggcgcggacttcgccaag
ggcacgtccagcaaggccaccaagctcgtgcatggcggcgtgcgctacctggcgcagggc
aatatcagcctggtgcgcgaggcgctgcacgaacgcggcctgctcaaccgcaatgcgccc
cacctggcctggccgctgggtttcgtggtgccggcctattcgctgctggaccagcctttt
tatggcgtgggcctgaaggtgtacgacatgctggccggcgcgctcaacctggcgcccagc
cgctggctgtcgcgcgacgagacgctgacccacgcgcgcacgctggctcccgagatcaag
ggcaagcggctgcgcggcggcgtgctgtactacgacggccagttcgacgacgcgcgcctg
gccgtctcgctcatgcgcacgctctttgaccagggcggcacggccatcaactatgtgcgc
gtcaccggcctgagccgcgacgcgcagggccgcgtcgatggcgtgcagaccgaggacgcc
atcgatggcgcgcgccatgccatacgcggcaaatgcatcgtcaacgccaccggcgtctgg
gtcgacgcggtgcgccgcatggacgatcccgccgcgcagaccatggtcgcgcccagccag
ggcgtgcacctgacgctgccgcgcgacttcctgcccggagacgaagccatcctggttccc
aagacggatgacggccgtgtgctcttcatggtgccctggaacggccacaccattgtcggc
accaccgacacggcgcgccaggacctgcccgccgatccgcgcccgctgccgggcgaggtg
gagttcatcctggaaacggcggcgcgctatctcacgcgcaagcccacgcgcgccgacgtc
accagcgtatgggccgggctgcggccgctggtcaaggccacgggcgaggcgtcgaccaaa
tcgctatcgcgcgagcacaccatcctggtctccaagagcggcctgatcaccgtgaccggc
ggcaagtggaccacgtatcgcaagatggcccaggacgtggtggacaccgccatcgaaaac
cagctgctgccccaggccgcctgtcgcagcgccgacctgcgcctgcacggcgcgccggcg
cccggcgcccggctggccgcgccccagggcacgcccgatagctattacggcaccgacctg
ccggccttgcgcgccctgcccggggccgaccgcatgctggtcaaggccagcggcctgacc
gaagcgcatgtgcgctatgcggcgcgccatgagctggcgcgcacggtcgaggatgtgctg
gcgcgccgcaaccgcgcgctgttcctggatgccgaagccgcgcagctggccgcgcccgaa
gtggcccgcctgctggcccaggagttgggccatgacgcggcctggcagcagcgcacgctg
gccgacttcgaggccgtggcggcgaccttccgcctgccgccggcctga

DBGET integrated database retrieval system