KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159607Help
Entry
110159607         CDS       T05002                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     110159607 (ace)
Peptidases [BR:bpec01002]
 Metallo Peptidases
  Family M2
   110159607 (ace)
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110159607 (ace)
CD molecules [BR:bpec04090]
 Proteins
  110159607 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1285 aa AA seqDB search
MMATSGDRSLRPLLLLLPVLGLCGALPTEWLPGNYPDTVAGVLSFLSDYNSTAEEVLYYS
VTASWNYNTNLTAHNSQLQVQASMDEQAFSEAWGHKAKTTFSAAVLNSLPKQDKKLYDKI
VVLGPANLPTAEREEYNTILSTMDNIYSTAKVHPQENVSWSLEPELTEIMANSRSYKKLL
FAWEGWHNASGVPLKNYYPRFVELSNKGSVADGFKDTGAYWRSWYESPTFQEDLRSLYQT
VEPLYLHLHAFVRRQLYNQYGPKYINLKGPIPAHLLGNMWSQTWNNIYGMMIPFPNKPNL
DVTAEMERQGYNATHMFRVAEEFFTSLGLEPMPQEFWDESMLVKPEGREVVCHASAWDFY
NRKDFRIKQCTTVTMEQLFTVHHEMGHVQYYLQYKDLPVGFRRGANPGFHEAIGDVLSLS
VSTPKHLHTIGLLGSSASDTETDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGDTAADR
YNYDWWYLRTKYQGICPPTRRTEEHFDAGAKYHVPGNTPYIRYFVSFILQFQFHEKLCEA
AKHTGPLHTCDIYRSKEAGAILKKVLEAGSSQAWEEVLLNALGTSKMDSSSLIRYFQPIL
TWLEEQNKGEILGWPDFDWTPPVPEGYPEDIDKETDEAKAKMLLDEYNTTAEVVWNAYTE
ASWAYNTDINEANKQAMLQKNLEMSAHTLEYGKKARQFDTTDFQDAQVKRIIKKLSDIER
AALSSGELEEYNNLLSNMETKYSVAEVCRANNTCHPLDPDLQKIMAESRDYDELLFAWKG
WRDAAGKVLRQDYKRYVELANKAATLNGHSDNGAFWRSLYETPTFEQDLEALWKELEPLY
HNVHAYVRRALYKKYGAEHINLKGPIPAHLLGNMWAQTWSGIMDLVMPYPDATQVDATPA
MVAQKWDAHRMFKESENFFTSLGLMEMPPEFWDKSMLEKPSDRKVVCHASAWDFYNRKDF
RIKQCTVITMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPK
HLQSIGLLDKVESNSESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPPTEYNKEW
WNLRMKYQGLCPPVARTEEDFDPGAKFHIPANVPYVRYFVSFVIQFQFHKALCNAAKHTG
PLHTCDIYQSKEAGKLMGDVMKLGFSKPWPEAMAMITGQPKMSALPLMEYFQPLITWLEE
ENAKNGDVLGWPEYDWKPYVVSKQEKSKVDFLGMNLDSSSAVAGQWILLVAGLVLLVATI
LLAYKYRKSKKPEKSISTLELKSTS
NT seq 3858 nt NT seq  +upstreamnt  +downstreamnt
atgatggccaccagcggagacaggtccttgcgccctctgctgttgctcctgccagtcttg
ggactctgtggagctctgcctacggagtggttgccggggaactatccagacacagtggcc
ggagtgctgtcttttctcagtgactacaacagcacggccgaggaagtgctttactacagt
gtgacggcatcatggaactacaacaccaacctgacggcgcacaactcacagctgcaggtc
caggcctccatggatgagcaggcctttagtgaagcctggggtcacaaagccaaaaccaca
ttttctgctgcagtgctgaattctcttcccaaacaagacaaaaaattatatgacaagatc
gttgtcctgggacctgccaacctgcccaccgccgaaagagaggagtacaacaccatcctc
agcaccatggacaacatttactccacagccaaagtccacccacaagaaaatgttagctgg
agtctggagccagaactgacagaaatcatggccaattctagaagctacaaaaagctcctc
tttgcctgggagggctggcacaacgcgtccggggttcccctcaaaaattactacccaaga
tttgtggaactcagcaataaaggctctgtagctgatggttttaaagacaccggagcgtac
tggaggtcttggtatgaaagcccaacctttcaagaggatttgaggagtctttaccaaaca
gtggaacccctctacctgcatcttcatgcatttgtgcgtcgccagttgtacaaccagtat
ggccccaaatatatcaacctcaaagggcccattccagctcacctcctcggaaacatgtgg
tctcagacgtggaacaacatctatgggatgatgataccttttccaaacaaacctaaccta
gatgtgacagctgaaatggagagacaaggctacaatgccacacacatgttcagagtagca
gaggagttcttcacctctctgggcctggaaccaatgccacaggagttctgggatgagtcc
atgttggtgaagcctgaaggtcgtgaggtggtgtgccacgcttcagcctgggacttctac
aaccggaaagacttcaggatcaagcagtgcaccacagtgaccatggagcagttgttcact
gtgcaccatgagatgggacacgtgcagtactacctgcagtacaaggacctacctgtaggg
ttcaggcgtggagctaacccgggcttccatgaggccattggagatgtgctgtctctatct
gtgtccaccccaaaacacctgcacaccatcggcctgctgggctccagtgcatctgacaca
gaaaccgacattaactatttgttgaagatggctttggagaaaatagctttccttcccttt
ggatacctcattgaccagtggagatggaacgttttcagtggagatacagcagcagatcgt
tacaactatgactggtggtacctcagaactaaataccaaggcatctgcccacccaccaga
cgcacagaggagcactttgatgcaggcgcaaaataccacgtccccggaaacacaccatac
atcaggtattttgtcagcttcattttgcagttccaattccatgaaaaactttgtgaagcc
gctaaacacactggaccactgcacacatgtgacatctaccgctcaaaggaagctggagcc
attttgaagaaggttcttgaggcgggatcttcccaggcttgggaggaggttcttctgaat
gcgttagggactagtaagatggattcttcatcactcatcagatactttcagcccatcctt
acctggctggaggagcagaataaaggcgagattctaggctggcccgacttcgactggact
ccccctgttcccgagggatacccagaagatattgacaaggaaacggatgaggccaaggca
aagatgctattggacgaatacaacaccactgcagaagttgtgtggaacgcttacaccgaa
gcttcttgggcttacaacactgacatcaatgaggccaacaagcaggccatgctccaaaag
aacctggagatgtccgcccacacgctagagtacgggaagaaggcgcgtcagtttgacacc
acggacttccaggacgcgcaggtcaaacgtatcatcaagaaactcagtgacatcgaaaga
gctgcgttgtcttctggagagctggaggagtacaacaatctgctgtccaacatggagacc
aagtacagtgtggcagaggtgtgcagagccaataatacctgccatcctttggacccagat
cttcagaagatcatggccgagtccagggactacgatgagctgctgtttgcttggaaagga
tggagagatgctgcaggcaaagtcctccgtcaggattacaagagatatgtggagctggcc
aacaaggctgccacactcaatggtcacagtgataacggggcattctggcgctctctctat
gaaactcccacttttgagcaagacctggaggcgctgtggaaagagctggagccactctat
cacaacgtgcacgcctatgtccgccgcgcactctacaagaagtacggagcagagcacatc
aacctcaaagggcccatccccgctcacttactggggaacatgtgggcgcagacgtggtcg
gggataatggacctggttatgccctacccagacgccacacaagttgacgccactccggcc
atggtggctcagaaatgggatgctcatagaatgtttaaggaatcagaaaacttcttcacc
tctctgggcctgatggagatgccaccagagttctgggacaagtcaatgctggagaaaccc
tccgatcgcaaagtggtgtgccacgcatcagcatgggacttctacaacagaaaggacttc
agaatcaaacagtgcacagtgatcaccatggacgacctgatcacagtgcatcacgagatg
ggacatgtgcaatactttctgcagtacaaggaccagccggtgtccttccgggatggagct
aaccccgggttccacgaggccatcggggatgtcttggctctgtctgtgtccactcccaaa
catctacagagcattggtctgctggacaaagtggaaagcaactctgagagtgacattaac
ttcctgatgagcatggcccttgataagattgccttcctgccttttggttaccttatggac
cagtggagatggaaagtatttgatgggcgcatcccacccacagagtacaacaaagagtgg
tggaacctcagaatgaagtaccagggtctgtgtccacctgtcgcccggaccgaggaagat
tttgacccgggtgcaaagttccacatcccagcaaacgtgccatatgtcaggtattttgtc
agcttcgtgatccagtttcagttccacaaagctctgtgtaatgccgccaaacacactggt
ccccttcatacatgtgatatttaccaatctaaagaggctgggaagcttatgggtgacgta
atgaagctaggattcagtaaaccctggcctgaagctatggccatgatcaccggtcagccc
aaaatgagcgccctgccgctcatggagtatttccaaccactcatcacttggttggaggag
gagaatgccaagaatggagatgttcttggatggcccgagtacgactggaaaccctacgtg
gtgtcaaaacaagaaaagagtaaagtggacttcctcggcatgaatctggacagctcttca
gcagttgccggacagtggattctgcttgtcgctggtctggtcctccttgtggccacaatc
cttttagcgtataaatacaggaagtcaaagaaacctgagaagtccatatccactctggag
ctcaagtccacatcgtag

DBGET integrated database retrieval system