KEGG   Bordetella pertussis 137: Q425_11890Help
Entry
Q425_11890        CDS       T03754                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpeu  Bordetella pertussis 137
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpeu00001]
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Q425_11890
Enzymes [BR:bpeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Q425_11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1233872..1235476)
Genome map
AA seq 534 aa AA seqDB search
MTAPTLAPIDPPARAQLLTDLQGAPDWDVIVIGGGATGLGTAVDAAARGYRTLLVEAADF
AKGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYSLLDQ
PFYGVGLKMYDMLAGKLNLAPSRWLSRGETLRHAATVAERVNGRALRGGILYYDGQFDDA
RLAIALMRTLYDLGGVALNYARAVGLTRTDGRVDGVTVADALGELRVTLRAKCVVNATGV
WVDAVRRMDDPAAQTMVAPSQGVHLTLPRDFLPGEDAILIPKTDDGRVLFVVPWNGHTIV
GTTDTPRTDLPLDPQAGQNEIDFILATAARYLSRKPTRADVTSVWAGLRPLVKATGEAST
KSLSREHTIVVSKGGLVTVTGGKWTTYRKMAQDVVDTAIEHKLLAAAPCRTSELPLHGAP
ADGQPNGAPHGTPDSYYGTDLATLRALPGADRMLVKASALTEAHVRYAARHELARTVEDV
LARRNRALFLDAEAALLAAPEVARILAQELGHDEAWSRATLAEFEAVAAHYRLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccctaccctcgctcccatcgacccgcccgcgcgcgcgcaactgcttaccgac
ctgcaaggcgcccccgattgggatgtcatcgtcatcggcggcggcgccaccggcctgggc
accgccgtcgatgccgccgcgcgcggctaccgcaccctgctggtcgaggccgccgacttc
gccaagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcg
cagggcaatatcagcctggtgcgcgaggccctgcacgaacgcggcctgctcaaccgcaac
gcgccgcacctggtgtggccgctgggcttcgtcgtgccggcctacagcctgctggaccag
ccgttctacggcgtcggcctgaagatgtacgacatgctggccggcaagctgaacctggcg
cccagccgctggctgtcgcgcggcgaaacgctgcgccacgccgccaccgtggccgagcgc
gtcaacggacgagccttgcgcggcggcatcctgtactacgacggccagttcgacgacgcg
cgcctggccatcgccctgatgcgcaccctgtacgacctgggcggcgtggcgctgaactat
gcgcgcgcggtcggcctgacgcgcacggacggccgcgtcgacggcgtgacggtggccgac
gcgctgggcgagctgcgcgtgacgctgcgcgccaaatgcgtggtcaacgccaccggcgtg
tgggtcgacgcggtgcgccgcatggacgaccccgccgcgcagaccatggtggcgcccagc
cagggcgtgcacctgacgctgccgcgcgacttcctgcccggcgaagacgccattctcata
cccaagaccgacgacggccgggtgctgttcgtggtgccctggaacggccacaccatcgtc
ggcaccaccgacacgccgcgcaccgacctgccgctcgatccgcaggccggccagaacgaa
atcgacttcatccttgccaccgcggcgcgctacctgagccgcaagcccacccgcgccgac
gtgaccagcgtgtgggccggcctgcgcccgctggtcaaggccaccggcgaagcctcgacc
aagtcgctgtcgcgcgaacacaccatcgtggtctccaagggcgggctggtcacggtcacc
ggcggcaaatggaccacctaccgcaagatggcccaggatgtggtcgacaccgccatcgag
cacaagctgctggccgcggcgccatgccgcacgtccgagctgccgctgcatggcgcgccg
gccgacgggcagcccaacggcgcgccccacggcacgcccgacagctactacggcaccgac
ctggcgacgctgcgcgcgctgcccggcgccgaccgcatgctggtcaaggccagcgccctg
accgaggcgcacgtgcgctatgccgcccgccacgaactcgcgcgcaccgtggaggacgtg
ctggcccgccgcaatcgcgccctgttcctggacgccgaggccgccctgctggccgcgccc
gaagtggcccgcatcctggcgcaggaactcggccacgacgaagcctggagccgcgccacg
ctggccgagttcgaggccgtggccgcgcactaccggctggcctga

DBGET integrated database retrieval system