KEGG   Bathycoccus prasinos: Bathy15g01950Help
Entry
Bathy15g01950     CDS       T03089                                 

Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg00240  Pyrimidine metabolism
bpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bathy15g01950
Enzymes [BR:bpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Bathy15g01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 Membralin
Motif
Other DBs
NCBI-GeneID: 19011501
NCBI-ProteinID: XP_007508989
UniProt: K8F5H9
LinkDB All DBs
Position
15:complement(362985..363917)
Genome map
AA seq 310 aa AA seqDB search
MTMISYSSSATSFAARNAKSHVASSSSFSSFSFASSRRRSTMMMISNDENEKKNNTNATM
TTKKTTKKKNGFRCFASRGGGEVSVCDEEEENASKEVTSSLNNSSVANSTNNNIKRNESE
EETQKGVGSVHLILGPMFAGKTTRLLERVKQLEESVSANVLLLKSDKDTRYAKDKVVTHD
GRGRECFPVKSLELEVVVKTVGERKWNECDVVAVDEAQFLTNLYEFCRVAADEHNKIVLV
AGLNGDFKRETFGEVQETLPLCDSVTKLTAKCKCGRPALFSKRIVNVGDGQELVGGADKY
LPACRRCFLN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgatttcttattcttcttccgcgacgagttttgctgcgaggaatgcgaagagc
cacgtggcgtcgtcgtcatctttttcttccttttccttcgcatcatcgaggcgcagaagc
acgatgatgatgatttcgaacgacgagaacgagaagaagaacaatacgaacgcgacgatg
acgacgaagaaaacgacgaagaaaaagaacgggttcagatgtttcgcgtcgcgaggagga
ggagaagtctcggtgtgcgacgaggaggaggagaacgcatcgaaagaagtgacttcctct
ttgaacaacagctcggtcgcgaatagtacgaacaataacatcaaaagaaacgaaagcgaa
gaggaaacgcagaaaggcgtcgggtcggtgcatttaattttaggacccatgtttgccggg
aaaacgacgcgtttattagagcgagtgaaacagttggaagagtccgtgagcgcgaacgtt
ttgctcttaaagtcggacaaagatacgaggtacgccaaggataaagtagtcacgcacgac
gggagagggagagagtgtttcccggtgaagtcgctggagttggaggtggtggtgaagacg
gtcggggaacggaaatggaacgagtgcgacgtcgtcgcggtggacgaggcgcagtttttg
acgaatttatacgagttttgtcgagtcgcggcggacgagcacaataagattgttttagtc
gccgggttgaacggcgatttcaaaagagagacattcggtgaggtgcaagagacgttgccg
ctgtgtgattcggtgacgaaattaaccgcgaagtgtaagtgcggacgaccggcgttgttt
agtaagagaatcgtaaacgtcggggacgggcaggagttagtcggcggcgcggataaatat
ttgccggcgtgcagacgatgctttctaaattaa

DBGET integrated database retrieval system