KEGG   Paraburkholderia phymatum: Bphy_2399Help
Entry
Bphy_2399         CDS       T00704                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00010  Glycolysis / Gluconeogenesis
bph00520  Amino sugar and nucleotide sugar metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
Module
bph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_2399
   00520 Amino sugar and nucleotide sugar metabolism
    Bphy_2399
Enzymes [BR:bph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Bphy_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Tex_YqgF FGGY_N Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ACC71574
JGI: Bphy2399
UniProt: B2JFU9
LinkDB All DBs
Position
1:complement(2695779..2696591)
Genome map
AA seq 270 aa AA seqDB search
MARTKESLRRTAASSDEKILAIDIGGTGLKAAVIDAGGEMKSERARVATPHPCTPEQLVD
TLAKLVQPLIDAHRPTLMSIGFPGVVRDNRVLTAPNIGDPGWRGFALADQLAARVGGLPV
RMINDAEMQGFAAIEGRGLEFVLTLGTGAGTALFRDGELMPHLELAHHPVSKGRTYDEYI
GNAAREKAGNKRWNRRVEKVIGILASLVNYDKLWIGGGNAGRLTFELPSDAAIVSNAAGI
EGGAKLWHPKSVRETRQLPEANRNAGPFAK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttggccaggactaaagaatcgttgcgacgcacagccgccagcagcgacgaaaagatactc
gcgatcgacattggcgggacgggcctgaaggccgccgtgatcgacgcgggcggcgagatg
aaaagcgagcgtgcgcgcgtggcgacaccgcatccgtgcacgccggagcaactggtcgat
acgctcgcgaagctcgtgcagccgcttatcgacgcgcatcgtccgacgctgatgtcgatc
ggctttccgggcgtcgtgcgggacaaccgagtgctgactgcacctaatatcggcgatccg
ggctggcgcggctttgcgcttgcggaccagcttgccgcgcgtgtcggcggcttgcccgtg
cgcatgatcaacgatgccgagatgcagggcttcgccgcgatcgaaggacgcggcctcgaa
ttcgtgctgacgctaggaaccggcgcgggtacggcgctctttcgcgacggcgaactgatg
ccgcacctcgaactcgcgcatcatcccgtcagcaagggacgcacgtatgacgagtacatc
ggcaatgcggcgcgcgagaaggcgggcaacaagcgctggaaccggcgcgtcgagaaggtg
atcggcatcctggcttcgctcgtcaattacgacaagctgtggatcggcggcggcaatgcc
gggcgcctgacattcgagttgccttccgatgcggccatcgtgtcgaatgcggcgggcatt
gaaggcggcgcgaaactgtggcatccgaaatcggtgcgcgagacgcggcagttgcctgaa
gcgaaccggaacgcggggccgttcgcgaaatga

DBGET integrated database retrieval system