KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0818Help
Entry
BURPS1106A_A0818  CDS       T00480                                 

Definition
(GenBank) putative phosphonopyruvate hydrolase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS1106A_A0818
Enzymes [BR:bpl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BURPS1106A_A0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:complement(813644..814555)
Genome map
AA seq 303 aa AA seqDB search
MPIRELISAPITNEQRRRSFKEKLATGRALRFIESHSPISAMISEKVYVAHGASQSEFDG
FWSSSLTDSTLRGRPDIEILDIASRLANVQHIFDVTTKPLIIDGDTGGKPEHFALNVQSL
ERSGVSAVIIEDKTGLKKNSLLGNDVIQHQESIEDFCEKIRVGKAAQITDDFQIIARVES
LILDKGMPDALARAAAYCEAGADGVMIHSRKKDADEVIEFAQRFRACRRDAYLVCVPTSF
NAISFSELARHFSVVIYANHLLRAAYPAMLAVAEGILAHGRTLEIEERCLPVNEILKLIP
GTA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgccaataagagaattaataagcgcgccgattaccaacgaacaaagacgccgatcgttc
aaggaaaagctggcaaccgggcgcgcgctgcgcttcatcgaaagccacagcccgatttcc
gcaatgatcagcgaaaaggtttatgttgcgcacggagcgtctcaatccgagttcgacggc
ttctggtcgagttcactgaccgactcgacgctgcgcggccggccggacatcgaaatcctg
gatatcgcgagcaggctcgccaatgtccagcatattttcgacgtgacgacgaagccgctc
atcatcgacggcgacacgggcggcaagcccgagcatttcgcgctgaacgtgcagtcgctc
gagcgatccggcgtctcggcggtgatcatcgaggacaaaacggggttgaagaaaaattcg
ctgctcggcaacgacgtgattcagcaccaggaatcgatcgaggatttctgcgaaaagatt
cgcgtcggcaaggccgcgcagatcaccgacgattttcagatcatcgcccgcgtcgagagc
ctgattctcgacaagggcatgccggacgcgctcgcgcgcgcggccgcgtattgcgaggcc
ggcgccgacggcgtgatgatccacagccgcaagaaggacgcggacgaagtgatcgaattc
gcgcagcggttccgcgcatgccgccgcgacgcgtatctcgtgtgcgtgccgacgagcttc
aacgcgatttcgttcagcgagctcgcgcgccacttcagcgtcgtgatctacgcgaatcac
ctgctgcgcgccgcgtatccggcgatgctcgcggtcgccgagggcattctcgcgcacggc
cgcacgctcgagatcgaagaacgctgcctgcccgtcaacgagatcctgaagctcattccg
ggaaccgcgtga

DBGET integrated database retrieval system