KEGG   Burkholderia plantarii: bpln_2g01050Help
Entry
bpln_2g01050      CDS       T04139                                 

Definition
(GenBank) Saframycin Mx1 synthetase
Organism
bpla  Burkholderia plantarii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(132328..137736)
Genome map
AA seq 1802 aa AA seqDB search
MNAFEATMSRFDHLQNFGQCLRHWATVKPHDTAFRFLTDDVVEAPRLSFAELDRRATAIA
ARLARECPRGEPVLLLYRPGLDFIAAFFGCLYAGCAAVPAYPPSGRATRRNRLAAIIADC
GAGAILTSDDLVEAIREEIAQAEAPVRADVIGTDALLAAPGGTLDTSEAVLPASHLAFLQ
YTSGSTGRPKGVRVTHRNLLANERAIREGFRHGPDTVFVGWCPLYHDMGLIGNVLQPVYL
GIPSVLMSPFAFLQQPLKWLRAISTYGATTSGGPNFAYELCATRIAEADKAGLDLSSWRV
AFNGAEPIRASTLDRFAAAFADYGFDAGAMFPCYGMAETTLFVSGAVPGAGALTRRVDAL
ALQAGRCADAVDGQPAVELVSSGRVGGDQQVRIVDPHSLHASGPGEIGEIWVRGGSVADG
YWNREDDTRAQFDARIAGEDSPPFLRTGDLGLLDGGELYVTGRLKELIIIRGRNHYPTDI
EQTVEQSSADFRAGCGAAFAIDGEGGERLVVVQEIQRAVRKSLDAEEAGRRAAAAVAAAH
GIPLHELVLVQAGVVPKTSSGKNQRTLVRQHYLEGKLPVLARTQPGAGAGAATVTTAATP
AAPGGSVDELSERVIVAMLGTAGAARPEARAASPLALGLDSLALVDLQTRLARELGIAVE
LDDLMDERPVAELARDLAARAFDGGGASGGEAPAPALPPAADPTALTPYQEAIWTAQLWD
PALPCFNLVLPLRVRAPLSAGHVREALAALTVAHPGLASRFVQDGNGDVRQQPAAATAGL
LDVINCAGQSDDALRARIVASASAPIDLAGGPVFRAELLSRAPDDHLLVLIAHHLVADLG
SLQTVLADFAEFHACLAGDRPLPARAIAAAGVAVPDYRTRLAALLHGPRAEADRQYWAAR
LATPIEPLALPLALPGEAPAGVVAGSGMSVDVDLDAALAGALDALCASRRVTRNMALLAA
FFAFLHRYTAQRDVAVVTPAAVRPGGEFDDWVGYGVNLLVIREAVDGELPFAALLAAMKQ
TVAGALAHRTTPFIDLARRFARRDDDVRHPFSRVLFAYHNLNRLPQAADLLAGTAGQPLA
VGALALESFPVPTPAAQTDLALVAIQAGERLVLRFEYDATLASRAAIERMAAHFRTLLGA
LLAQPDQPVARAALLDPAERERQLVTWNRRPLAAPATGPAASATMNLAADYATVHAMIDA
MSRRVPERLAVRTDTEQLDYAQLRRDSDALAAALHARGVRHGDVVGVGLPRDVRLPIMLL
AIWKAGAAYLPIDLGVPAERVRQMLDDAQAALIVAPAALRGALGDDGRAWVTPEALAADA
AAGESPAAPESRAGRDSLAYVLFTSGSTGRPKGVEIEHRNVLSLLAWIGARYSAGELAAV
FAGTSIAFDISVFELFGPLAHGGCVVIGENPATPPATPVSLLNTVPSAAAALLETGALPA
SVVTVNLAGEPLRQSLVDALYARGTIGKVYDLYGPTEDTVYSTAVLREPGGFDTIGTPLP
GKRVYLLDAHGEPVPVGVAGELFLAGDGQARGYRNRPDLTGRAFVAVPALADLETRLYRT
GDIGRLLPDGRIVLSGRRDHQVKIRGHRVELGEIEAVLLRQPGVRDAVVVQTRHAERSGD
DGDSRDALLVAYLAVDLAVGDAADEAVGTPPRPVVTVEAVREYAAASLPSYMRPTGYVLL
DALPRNPSGKVDRAALPRFDPVAQDDAAAPVSDTQRAVLAIWEAVLGFQGFGIHANLFEL
GGHSLQVIQIIARCRERFGVEISLAKVLERTTVADLAAYVTLLAARSGAADEPGGVREEV
LF
NT seq 5409 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcctttgaagccacgatgagtcggttcgatcatctgcagaattttggccagtgc
ctgcgtcactgggcaacggtcaagccgcacgacaccgcgttccggttcctgaccgacgac
gtcgtcgaggcaccgcgactgagcttcgccgaactcgaccggcgcgccaccgcgatcgcc
gcccgcctcgcgcgcgaatgcccgcgcggcgagcccgtgctgctgctctatcggcccggg
ctcgacttcatcgccgcgttcttcggttgcctctacgcgggctgcgcggcggtgccggcc
tatccgccgtcgggtcgcgccacgcgccgcaaccggctcgccgcgatcatcgccgactgc
ggggccggcgcgatcctgacgagcgacgacctggtcgaggcgatccgcgaggagatcgcg
caggcagaggcaccggtgcgcgccgacgtgatcggcaccgacgcgctgctggccgcgccg
ggcgggacgctcgacacgagcgaggcggtgctgcccgccagccacctggcgttcctgcag
tacacctcgggctcgaccggccgccccaagggggtgcgcgtcacgcaccgcaacctgctc
gccaacgagcgcgcgattcgcgagggcttccgccacggcccggacacggtgttcgtcggc
tggtgcccgctgtatcacgacatgggcctgatcggcaacgtgctgcagcccgtctacctt
ggcatcccgtcggtgctgatgtcgccgttcgcgttcctgcagcagccgctcaagtggctg
cgcgcgatctcgacctatggggcgaccaccagcggcggcccgaacttcgcctacgaactc
tgcgcgacgcgcatcgccgaggccgacaaggccgggctcgacctgtcctcgtggcgcgtc
gcgttcaacggcgccgagccgatccgcgcctcgacgctcgacaggttcgcggccgcgttc
gccgactacggcttcgacgcgggcgcgatgttcccgtgctacgggatggccgagaccacg
ctgttcgtgtcgggcgcggtgcccggtgccggcgcgctcacgcgccgcgtcgacgcgctc
gcgctgcaggccgggcgctgcgccgacgcggtcgacgggcagcccgccgtcgagctggtg
agttcggggcgcgtgggcggcgaccagcaggtgcgcatcgtcgatccgcacagcctgcac
gcgagcggccccggcgagatcggcgagatctgggtgcgcggcggcagtgtcgccgacggc
tactggaaccgcgaggacgacacgcgcgcgcagttcgacgcgcgcatcgccggcgaggac
tcgccgccgttcctgcgcaccggcgatctcggcctgctcgacggcggcgaactctacgtg
acgggccggctcaaggagctgatcatcatccgcgggcgcaaccactacccgaccgacatc
gagcagaccgtcgagcagagcagcgccgacttccgcgccggctgcggcgcggcattcgcg
atcgacggcgagggcggcgagcgcctggtggtggtgcaggagatccagcgcgccgtgcgc
aagtcgctcgacgccgaggaggccgggcggcgcgccgccgccgccgtggccgccgcgcac
ggcattccgctgcacgagctggtgctggtgcaggccggcgtggtgccgaagacctcgagc
ggcaagaaccagcgcacgctggtgcgccagcactacctcgaaggcaagctgccggtgctc
gcgcgcacccagccgggggcgggcgccggcgccgccacggtcaccacggcggcaacgccg
gctgcgccgggcggcagcgtcgacgaactgagcgagcgcgtgatcgtcgcgatgctgggc
acggcgggcgcggcgcgccccgaagcgcgagccgcctcgccgctcgcgctcggcctcgat
tccctcgcgctcgtcgatctgcagacgcgcctggcgcgcgaactcggcatcgccgtggaa
ctggacgacctgatggacgaacggcccgtggccgaactggcgcgcgacctggccgcgcgc
gcgttcgacggcggcggcgcgagcggcggcgaggcgcccgcgcccgccctgccgccggcc
gcggacccgaccgccctgacgccgtaccaggaagcgatctggacggcccagctgtgggac
cccgcgctgccctgcttcaacctggtgctgccgctgcgggtccgggcgccgctctcggcc
ggccacgtgcgcgaggcgctcgcggcgctgacggtcgcacacccgggcctcgcgagccgc
ttcgtgcaggacggcaacggcgacgtgcggcagcagccggcggcggcgacggccgggctg
ctcgacgtgatcaactgcgccgggcagtccgacgacgcgctgcgcgctcgcatcgtcgcc
tccgccagcgcgccaatcgacctggccggcggccccgtgttccgcgccgagctgctgagc
cgcgcgcccgacgatcacctgctggtactgatcgcgcatcacctggtggccgacctcggc
tcgctgcagacggtgctggccgacttcgccgaattccatgcctgcctcgccggggaccgg
ccgctgccggcacgcgccatcgcggccgctggcgtcgccgtgcccgactatcgcacccgg
ctcgccgcgctgctgcacggcccgcgagccgaggccgaccggcaatattgggccgcgcgc
ctcgcgacgccgatcgaaccgctggcgctgccgctcgcgctgcccggcgaggcgccggcg
ggcgtcgtggccggctcgggcatgagcgtcgatgtcgatctcgacgccgcgctggcgggc
gcgctcgacgcgctctgcgccagccggcgcgtgacgcgcaacatggcgctgctggcggca
ttcttcgcgttcctgcaccgctacacggcgcagcgcgacgtggcggtggtgacgccggcg
gccgtgcggcccggcggcgagttcgacgactgggtcggctacggcgtgaacctgctggtg
atccgcgaggcggtggatggcgagctgccgttcgccgcgctgctcgccgcgatgaagcag
accgtggccggcgcgctcgcgcaccgcaccacgccgttcatcgacctggcacggcgcttc
gcgaggcgcgacgacgacgtgcgccacccgttctcgcgggtcctgttcgcctatcacaac
ctgaaccgcctgccgcaggccgccgacctgctggcgggcacggccggccagccgctcgcg
gtcggcgcgctcgcgctcgaaagcttcccggtgccgaccccggccgcgcaaaccgacctc
gcgctggtcgcgatccaggccggcgagcggctcgtgctgcgcttcgagtacgacgccacg
ctcgcctcgcgcgccgcaatcgagcgcatggccgcgcatttccgcacgctgctcggcgcg
ctgctcgcgcagccggaccagccggtcgcgcgggccgcgctgctggatccggccgagcgc
gagcggcagctcgtgacgtggaaccgccggccgctggcggccccggccaccggcccggcc
gcgtcggccacgatgaacctggccgcggactacgccacggtccacgcgatgatcgacgcg
atgtcgcggcgcgtgcccgagcgcctcgccgtgcggaccgacaccgaacagctggactac
gcgcagctgcggcgcgattcggatgcgctggccgccgcgctgcacgcgcgcggcgtgcgc
catggcgacgtggtgggcgtgggcctgccgcgcgacgtgcgcctgccgataatgctgctg
gccatctggaaggccggcgccgcctatctgccgatcgacctcggcgtgccggccgaacgc
gtgcgccagatgctggacgacgcgcaggccgcgctgatcgtcgcgcccgccgcgctgcgc
ggcgcgctcggcgacgacggccgcgcctgggtcacgcccgaggcgctcgcggcggatgcc
gccgccggcgaatctccggccgcgcccgaatctcgcgccggccgcgacagcctcgcctac
gtgctgttcacgtcgggctcgaccgggcgtccgaagggcgtcgagatcgagcatcgcaac
gtgctgtcgctgcttgcgtggatcggtgcgcgctactcggccggcgagctggccgccgtg
ttcgcgggcacctcgatcgcattcgacatctcggtgttcgagctgttcggcccgctcgcg
cacggcggctgcgtggtgatcggcgagaacccggccacgccgcccgccaccccggtgtcg
ctgctcaacaccgtgccgtcggccgcggcggcgctgctcgagacgggcgcgctgccggcc
agcgtggtgaccgtcaacctggccggcgagccgctgcgccagtcgctggtggacgcgctg
tacgcgcgcggcacgatcggcaaggtctacgacctctacggcccgaccgaggacaccgtc
tattcgaccgcggtgctgcgcgaacccggcggcttcgacaccatcggcacgccgctgccg
ggcaagcgcgtctacctgctcgacgcgcatggcgagccggtgccggtgggcgtggcgggc
gagctgttcctggccggcgacggccaggcgcgcggctaccgcaaccggcccgacctgacc
gggcgcgcgttcgtcgcggtcccggcgctggccgacctcgagacgcggctctaccgcacc
ggcgacatcggccggctgctgcccgacggccgcatcgtgctgtcgggccggcgcgaccac
caggtgaagatccgcggccaccgcgtcgagctgggcgagatcgaggccgtgctgctgcgt
cagccgggggtgcgcgacgcggtggtcgtgcagacgcgccacgccgagcggtccggtgac
gacggcgacagccgggacgcgctgctggtcgcctatctggccgtcgatctggccgtcggc
gacgccgcggacgaggcggtcggcacgccgccccgcccggtcgtcaccgtcgaggcggtg
cgcgagtacgcggccgcctcgctgccgagctacatgcgcccgaccggctatgtgctgctc
gacgcgctgccgcgcaacccgagcggcaaggtggaccgcgccgcgctgccgcgcttcgac
ccggtcgcgcaggacgacgccgccgcgccggtcagcgacacgcagcgcgcggtgctggcg
atctgggaggcggtgctcggcttccagggcttcggcatccacgccaacctgttcgagctg
ggcggccattcgctgcaggtgatccagatcatcgcgcgctgccgcgagcgcttcggcgtc
gaaatctccctggccaaggtgctggagcgcaccacggtggccgacctggccgcctacgtc
acgttactggcggcgcgctccggcgccgccgacgaacccggcggcgtccgggaggaggtg
ctgttttga

DBGET integrated database retrieval system