Burkholderia pseudomallei BPC006: BPC006_I1985 Help Entry BPC006_I1985      CDS       T02301                                  Name (GenBank) mbtH domain-containing protein   KO K05375   MbtH protein Organism bpq  Burkholderia pseudomallei BPC006 Pathway bpq00261   Monobactam biosynthesis bpq01100   Metabolic pathways bpq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BPC006_I1985  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpq01008]     BPC006_I1985 Polyketide biosynthesis proteins [BR:bpq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BPC006_I1985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFR15855 LinkDB All DBs Position I:1915271..1915513 Genome browser AA seq 80 aa AA seqDB search MTQAQQPASAPADADDVVYAVVVNDEKQYSIWPTFRAVPAGWREAGVRGPKAECLAHIEA VWTDMRPASLRRHLDAARAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaacccgcgagcgcgcccgccgacgccgacgacgtcgtctacgcg gtcgtcgtcaacgatgaaaaacagtactcgatctggccgacgttccgcgcggtgccggcc ggctggcgcgaggccggcgtgcgcggcccgaaggccgagtgcctcgcgcacatcgaggcc gtgtggaccgacatgcgccccgcgagcctgcgccgccatctggacgcggcgcgcgcgtcg tga

DBGET integrated database retrieval system