KEGG   Burkholderia pseudomallei K96243: BPSL0443Help
Entry
BPSL0443          CDS       T00203                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPSL0443 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BPSL0443 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPSL0443 (gpmA)
Enzymes [BR:bps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPSL0443 (gpmA)
Membrane trafficking [BR:bps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BPSL0443 (gpmA)
Exosome [BR:bps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPSL0443 (gpmA)
  Exosomal proteins of melanoma cells
   BPSL0443 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1:complement(483930..484679)
Genome map
AA seq 249 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKR
AIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTP
PPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTPIRHYYLGDQEAIAKAQAA
VAQQGKSAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgatgtcgacctgaccgaacaaggcaaccgcgaagcccggcaggcgggc
cagctcctgaaggaagccggctacacgttcgatatcgcatacacgtcggtgctcaagcgc
gcgatccgcacgctctggcacgtgcaggaccagatggatctgatgtacgtgcccgtcgtg
cattcgtggcgcctgaacgagcgccattacggcgcgctgtcgggcctgaacaaggcggag
acggccgcgaagtacggcgacgagcaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgggcgacgagcgcgcgccgtacgccgatccgcgctacgcgaag
gtgccgcgtgagcagttgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctctggaacgaatcgatcgcgcccgcggtgaaggccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtatctcgacggcatctccgacgcggac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtctacgagctcgacgagagcctc
acgcccatccggcactactacctcggcgatcaggaggcgatcgcgaaggcgcaggccgcc
gtcgcgcagcagggcaagtccgcggcgtaa

DBGET integrated database retrieval system