KEGG   Burkholderia pseudomallei MSHR305: BDL_5683Help
Entry
BDL_5683          CDS       T02756                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BDL_5683 (ligD)
Enzymes [BR:bpse01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BDL_5683 (ligD)
DNA repair and recombination proteins [BR:bpse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BDL_5683 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:complement(2717627..2721109)
Genome map
AA seq 1160 aa AA seqDB search
MAGKLSVYRSRRRFGETPEPEGARRSPRRTKGAGRAGDESKRRARGDAAASSRGERAARR
GRAQQPARGRSALHYVIQEHHARRLHYDFRLELDGTLKSWAIPKGPSLDPSVKRLAVHVE
DHPLEYAAFEGEIPEGHYGAGSVIVWDRGAWTPAGGVAAARAGYRAGKLSFTLDGDKLHG
GWALVRSRGLRDSGGKHEQWLLIKERDGDARDEADYDVLRARPGSVLGGARSARARRGRA
AEPTERDAAAPKRARASVPKGRAEAKTSGRAPRTVSNGTAGAGKGASKRASKREGTNTGN
GARSGKGNGNGKGAGKGGATPRRKRTAAPQSFDVDSADTDSPAARGLALPAGLAARFGLS
GAKRAALPRTLRPQLATLVDAPPPGKDWLYEAKFDGYRVLIRIDRGAASRPIAVYTREGL
DWSAKFAAQLDALARLPVDRGWLDGEAVVLDRAGVPDFQALQNALGAGRSNDVTLFLFDV
PFLNGFDLRGVPLERRRALLAALVAAHASDVLRYSESLAFEAADLLTGACDAGLEGLIGK
RRDGRYVEGRSRSWIKLKCRRRQEFVIGGYTEPAGRRSGFGALLLGVYARAPGDEGDEGE
RRTRGAAETRDERRRASHASRTSCTSRAPDAGAARAPQARPLALRYVGRVGTGFGERTLR
ALARTLREHETGRMPFADVPRERSGTPVHWVKPVLVAECEFAEWTGDGIVRQASFVGLRE
DKPARTIVREQPQSMETEAMNEHADKHTDEHTDARAERRTGGRTRRKARDGGARDAPPLA
RHPKRGDAGSSARKGARDGEAGKRAAAGSSPSSSPSSSTSTSPSISASRRTRGGGRSASR
DRAGDADEGANEDANDHAPRERAGAPKVAGVRVSHPGRVIDPHTGTRKLDLVEYWEWIAP
WLLPHLKGRPVSLVRAPADIGGELFFQKHADKLEIPNVALHAGLDPGHEALITIDDVKGL
VGAAQMGTIELHTWNAHVSNIEKPDRAVFDLDPDPSLDWRAVIEAAQLTRALLDELGLVS
FCKTSGGKGLHVVVPLARHAGWDDVKAFAHAVARHMAATLPERFTATMGPRNRKGKIFVD
YLRNNRGASTIAAYSVRARPGLGVSVPIAWDELPDTTGAAQWTLANLHERLDALKHDPWR
AYAHVRQRVTAALRKRLSDG
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaaactcagcgtgtaccgcagcaggcggcgcttcggcgaaacgccggagccc
gagggcgcgcggcggtcgccgcgccgcacgaaaggcgcgggccgcgcgggcgacgaatcg
aagcggcgcgcgcgcggcgatgcggcggcgtcgagccgcggcgagcgcgccgctcgccgt
ggccgcgcgcagcagccggcgcgcggcaggtccgcgcttcattacgtgatccaggagcat
cacgcgcgccgcttgcattacgactttcgtctcgaactcgatggcacgctcaaatcgtgg
gcgatcccgaaagggccgagcctcgatccttcggtcaagcggctcgcggtgcacgtcgag
gatcatccgctcgaatacgcggcgttcgagggcgagattccggaaggccattacggcgcg
ggctcggtgattgtctgggatcgcggcgcatggacgcccgccggtggcgtcgccgccgcg
cgcgccggctatcgcgcgggcaagctgagcttcacgctcgacggggacaagctgcacggc
ggctgggcgctcgtgcgcagccgcgggctgcgtgacagcggcggcaagcacgagcaatgg
ctgctgatcaaggaacgcgacggcgacgcgcgcgacgaagcggactacgacgtgctgcgc
gcacggccgggcagcgtgctcggcggcgcgcggtccgcgcgggcgaggcgcgggcgcgcg
gccgagccgacggagcgcgacgccgccgcgccgaagcgggcgcgcgcttcagtgccgaaa
gggcgcgccgaagcgaagacgagcgggcgtgcgccgcgcaccgtgtcgaacgggactgcg
ggcgcgggtaagggcgcaagcaagcgtgcaagcaagcgcgagggcacgaataccggaaac
ggcgcgagaagcggcaagggcaacggcaacggcaagggcgcgggcaagggcggggccaca
ccgcgccgcaaacgcaccgccgcgccgcagtcgttcgacgtcgattcggccgataccgat
tcacccgcggcgcgcggcctcgcgttgcccgccgggcttgccgcgcgcttcggcctgagc
ggcgcgaagcgcgcggcgctgccgcgcacgttgcggccgcaattggcgacgctcgtcgat
gcgccgccgcccggcaaagactggctatacgaagcgaagttcgacggctaccgcgtgctg
atccggatcgatcgcggcgcggcgtcccgcccgattgccgtctacacgcgcgaggggctc
gactggagcgcgaaattcgccgcgcagctcgacgcgctcgcgcgcctgccggtcgaccgg
ggctggctcgacggcgaggcggtcgtgctcgatcgcgcgggcgtgccggatttccaggcg
ctgcagaacgcgctcggcgccggacgctcgaacgatgtcacgctgttcctgttcgacgtg
ccgttcctgaacggcttcgacctgcgcggcgtgccgctcgaacggcggcgcgcgctgctc
gccgcgctcgtcgccgcgcatgcgagcgacgtgctgcgttactcggagagcctcgcgttc
gaggccgccgatctgctgacgggcgcgtgcgacgcggggctcgaagggttgatcggcaag
cggcgcgatggccggtacgtcgaggggcgctcgagatcgtggatcaagctgaagtgccgg
cgcaggcaggagttcgtgattggcggctacacggagccggccggacggcgcagcggattc
ggcgcgttgctgctcggcgtgtacgcccgggcgccgggcgacgagggcgacgagggcgaa
cgaaggacgcgcggcgcggccgaaacgcgcgacgagcggcgtcgtgcatcccacgcatcc
cgcacatcctgcacatcccgcgcgcccgatgccggcgcggcgcgcgcaccgcaggcgcgg
ccgctcgcgttgcgctacgtcggccgcgtcggcaccggcttcggcgagcgcacgcttcgc
gcgctcgcgcggacgctgcgcgagcacgagaccgggcggatgccgttcgcggacgtgccg
cgcgagcgcagcggcacgccggttcactgggtgaagcccgtgctcgtcgccgaatgcgaa
ttcgcggaatggacgggcgacggcatcgtccggcaggcgtcgttcgtcgggctgcgcgaa
gacaagccggcgcgcacgatcgttcgcgagcaaccgcaatccatggagacggaagccatg
aatgaacacgctgacaaacatacggatgaacataccgatgcacgcgccgaacgtcgcacc
ggcggacgcacgcggcgcaaagcacgtgacggcggcgcgcgcgacgcgccgccgcttgcc
cgccatccgaagcgcggcgatgcgggatcgtccgcgcgcaagggcgcgcgggacggggag
gcgggcaagcgcgccgccgcgggatcgtcgccttcgtcttcaccgtcgagttcgacttcg
acttcgccttcgatttcggcgtcacggcgcacgcgcgggggcggtcgttccgcctcgcgc
gatcgagccggcgatgcggacgaaggcgcgaacgaagacgcgaacgatcacgcgccgcgc
gagcgcgccggcgcgccgaaggtggcgggcgtgcgcgtctcgcatcccggccgcgtgatc
gatccgcacacgggcacgcgcaagctcgacctcgtcgaatactgggaatggatcgcgccg
tggctgctgccgcatctgaagggccggccggtgtcgctcgtgcgcgcgcccgccgacatc
ggcggcgagctgttcttccagaagcacgcggacaagctggagattccgaacgtcgcgctg
cacgcggggctcgacccgggccatgaggcgctcatcacgatcgacgatgtgaaggggctc
gtcggcgccgcgcaaatgggcacgatcgagctgcacacgtggaacgcgcacgtgtcgaac
atcgagaagccggaccgcgcggtgttcgacctcgacccggacccgtcgctcgactggcgc
gcggtgatcgaggccgcgcagctcacgcgcgcgctgctggacgagctcggcctcgtgtcg
ttctgcaagacgagcggcggcaaggggctgcacgtcgtcgtgccgctcgcgcgccatgcg
ggctgggacgacgtgaaggcgttcgcgcacgcggtggcgcggcacatggcggcgaccctg
cccgagcgcttcaccgcgacgatggggccgcgcaaccggaagggcaagatcttcgtcgac
tatctgcgcaacaaccgcggcgcgagcacgatcgccgcgtactcggtgcgcgcgaggccg
gggcttggcgtatcggtgccgatcgcatgggacgaactgccggatacgacgggcgccgcg
caatggacgctcgcgaacctgcacgagcgtctcgacgcgctgaagcacgacccgtggcgc
gcctatgcgcatgtgcggcaacgcgtgacggcggcgttgcggaagcggctgagcgatggg
tag

DBGET integrated database retrieval system