KEGG   Burkholderia pseudomultivorans: WS57_19160Help
Entry
WS57_19160        CDS       T04870                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bpsl  Burkholderia pseudomultivorans
Brite
Translation factors [BR:bpsl03012]
 Eukaryotic Type
  Elongation factors
   WS57_19160 (tuf)
 Prokaryotic Type
   WS57_19160 (tuf)
Mitochondrial biogenesis [BR:bpsl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    WS57_19160 (tuf)
Exosome [BR:bpsl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   WS57_19160 (tuf)
  Exosomal proteins of breast cancer cells
   WS57_19160 (tuf)
  Exosomal proteins of colorectal cancer cells
   WS57_19160 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:1491279..1492469
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaaatttgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgacggtgctgacgaagaagttc
ggcggcgaagcgaaggcatacgaccagatcgacgcggcgccggaagaaaaggcgcgcggc
atcacgatcaacacggcacacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgccgactacgtgaagaacatgatcacgggtgcagcgcagatggac
ggcgcgatcctggtgtgctcggccgcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactgctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggcgaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgaacctggccgacgcgctggacacg
tacatcccgacgccggagcgcgcggttgacggtgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggtacggtggtgacgggtcgtgtcgagcgcggcatcatcaag
gtcggcgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccagggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaggtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgcgccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggcggccgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system