KEGG   Burkholderia pseudomallei MSHR511: BBQ_2433Help
Entry
BBQ_2433          CDS       T03012                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBQ_2433
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BBQ_2433
   00680 Methane metabolism
    BBQ_2433
Enzymes [BR:bpsm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBQ_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:2798422..2801406
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPAHAEPPARRAAKPARKLDGAAARPLAPTNAASAKPQGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDKAAAQTLEKM
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAAQAGTVAYALDKLKQA
GDASSKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARELAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYADIEEALAEHGLRA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAISRQAAVIFEHYLEQVHKLGAELSVSNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGTVPVRSAGRGAAP
VRATPYADAEEFAADLRVLTDSLALHHGESLATPRLAPLMRAAEVFGFHLASIDLRQSSD
IHEAVVAELLARGGVEADYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RAHAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGTPHANARNGLMVIP
LFETIADLRNASDIMRAFFALPGVGELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVDLFDERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEATMQTLSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLTGWYG
FGSAVAAYLDGAPDAAERGKRVALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTADALAEITGAHARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcttccgcc
ccggcgcacgccgagccccccgcccgccgcgccgcgaaacccgcacgcaagctcgacggc
gccgccgcgcgcccgctcgcgccgacgaacgccgcatccgcgaaaccgcaaggccgcacg
cgcgaagacaaggaccgcccgctcttcgaggacattcgctatctcggccgcctgctcggc
gacgtcgttcgcgaacaggaaggcgacgccgtgttcgacgtcgtcgagacgattcgccag
accgcggtcaagttccgccgcgaggacgacaaggccgccgcgcagacgctcgagaaaatg
ctgcgcaagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccatcacaaccgccgccgccgcatccacgcgctc
gcgggctccgcggcgcaggcgggcaccgtcgcgtacgcgctcgacaagctcaagcaggcg
ggcgacgcgtcgtcgaagacgatcaagcagttcttcgaaggcgcgctgatcgtgcccgtg
ctcaccgcgcacccgaccgaggtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcggctgctcgccgagcgcgaccagccgctgaccgcgcgcgagctcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgc
ctgaccgtcgccgacgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgac
gagctgcccgcgctctacgcggacatcgaggaggcgctcgccgagcacggcctgcgcgcg
cgcgtgccggcgttcttccagatgggcagttggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccgcgacgctcgacgaggcgatcagccgccaggcggcggtgatcttcgag
cattacctcgaacaggtgcacaagctcggcgcggagctgtccgtgtcgaacctgctcgtc
ggcgcgagcgacgcgctcaaggcgctcgccgccgcgtcgccggaccagtcgccgcatcgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggctcgcggccagcgcg
cgcgtgcggctcggcgagggcacggtgcccgtgcgcagcgcgggccgcggcgccgcgccc
gtgcgcgcgacgccgtacgcggacgcggaggagttcgccgccgatctgcgcgtgctgacc
gattcgctcgcgctgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatg
cgcgcggccgaggtgttcggcttccatctcgcgagcatcgatttgcggcagagctcggac
atccatgaagcggtggtcgccgaactgctcgcgcgcggcggcgtcgaggccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactactcggacctcgcgaaaagcgagctcggcgtgctcgag
cgcgcgcacgcgatccgcgcgcagttcggcgcgcgcgcggtgcgcaactacatcatttcg
cataccgagacagtgagcgatctcgtcgaggtgctgctgctgcagaaggaaacgggcctc
ttcgagggcacgctcggcacgccgcacgcgaacgcgcgcaacggcctgatggtgattccg
ctcttcgagacgatcgccgacctgcgcaacgcgtccgacatcatgcgcgcgttcttcgcg
ctgccgggcgtgggcgagctgctcgcgcaccagggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctatcgcgcg
gaactggcgctcgtcgatctgttcgacgagcgcgggatcaagctgcgcctgttccacggc
cgcggcggcacggtgggacgcggcggcggcccgacctatcaggcgatcctgtcgcagccg
cccggcacggtaaacggccagatccggctcaccgagcagggcgaggtgatcgcgagcaag
ttcgcgaacccggagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcagttgcccgcgttcgaggcgacgatg
cagacactgtcggacgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
ttcaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccggcccgcgtcgcgcaagctgcaggatccgaagaaccgcaagatcgaggacctgcgc
gcgattccgtggggcttctcatggggccagtgccggctgctgctcaccggctggtacggc
ttcggcagcgcggtcgccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctgaagaaaatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcggttgcgtcgcgctacgcgcagctc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcatcgc
acggcggatgcgctcgccgagatcaccggcgcgcacgcgcggctcgccgcgaatccgctt
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaagtc
gagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcggcgcgggatccat
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system