Burkholderia pseudomallei MSHR146: BBN_5594 Help Entry BBN_5594          CDS       T03024                                  Name (GenBank) chorismate lyase family protein   KO K03181   chorismate lyase [EC:4.1.3.40] Organism bpsu  Burkholderia pseudomallei MSHR146 Pathway bpsu00130   Ubiquinone and other terpenoid-quinone biosynthesis bpsu01100   Metabolic pathways bpsu01110   Biosynthesis of secondary metabolites bpsu01240   Biosynthesis of cofactors Module bpsu_M00117   Ubiquinone biosynthesis, prokaryotes, chorismate (+ polyprenyl-PP) => ubiquinol Brite KEGG Orthology (KO) [BR:bpsu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00130 Ubiquinone and other terpenoid-quinone biosynthesis     BBN_5594 Enzymes [BR:bpsu01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.3  Oxo-acid-lyases     4.1.3.40  chorismate lyase      BBN_5594 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Chor_lyase UTRA Motif Other DBs NCBI-ProteinID:  AHG72071 LinkDB All DBs Position 2:2679322..2679624 Genome browser AA seq 100 aa AA seqDB search MNTSSGWSRQPPASLSEREIHWLFAPGSLTERLSALGEYSLEPVDQHHAAACAADASLLG VEPDSPIWVREVVMRLDAQPCVTARSIASARTRSKRSGSR NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaacacttcgagcggctggtcgcgccagccgcccgcatcgctttccgaacgcgagatc cactggctcttcgcgccgggctcgctgacggaaagactgagcgcattgggcgaatactcg ctcgaacccgtcgatcaacaccacgcggccgcctgcgccgccgacgcgtcgctgctcggc gtcgagcccgattcgccgatctgggttcgcgaagtcgtgatgcgccttgatgcgcagccg tgcgtgaccgcgcgcagcatcgcgtcggcgcgcacgcgctcgaaacgcagtggaagccgc tga

DBGET integrated database retrieval system