KEGG   Bacillus pumilus SAFR-032: BPUM_3349Help
Entry
BPUM_3349         CDS       T00599                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00240  Pyrimidine metabolism
bpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BPUM_3349
Enzymes [BR:bpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BPUM_3349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK zf-C4_ClpX AAA_14
Motif
Other DBs
NCBI-ProteinID: ABV64002
UniProt: A8FID5
LinkDB All DBs
Position
complement(3327179..3327781)
Genome map
AA seq 200 aa AA seqDB search
MYVMKQSGWLEVICGSMFSGKSEELIRRAKRATFAKQEVKIFKPAIDNRYSTSSVVSHNG
SSVDGIAVASPKDIITHISERTDVIGIDEVQFFDETIIDIVTQLADKGYRVIVAGLDQDF
RGEPFGVVPHLMACAELVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPIILVGAQESYE
ARCRHHHEVPRLDVGTTLDN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgatgaaacaaagcggttggcttgaagtcatctgcggaagtatgttttctgga
aagtcggaagaattgattcggagagccaaaagggccacctttgccaaacaagaagtaaaa
atattcaaaccagcgattgataaccgatatagtactagctcagttgtttcacataacggt
tcatcggtcgatgggattgcagtagcctcaccaaaagacataataacgcacatatcagaa
agaaccgatgtcattggcatagatgaggtgcaattttttgatgagacaatcattgacatt
gtcactcaattggctgataaaggttaccgagtcattgttgcaggccttgatcaagacttt
agaggagagccatttggtgttgttccgcatttaatggcatgtgcagagcttgtaacaaaa
cttcaagcagtttgttcggtatgcggctccccagcgagtagaacacaacgcttaatcgac
ggtaaacccgcatcctatgatgatcccattattttagtaggtgcgcaggaatcatacgaa
gcacgatgcagacatcaccatgaagtaccaaggcttgacgttggtacaacacttgacaat
taa

DBGET integrated database retrieval system