KEGG   Brachyspira pilosicoli WesB: WESB_2245Help
Entry
WESB_2245         CDS       T02412                                 

Definition
(GenBank) glycosyl hydrolase BNR repeat-containing protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
bpw00511  Other glycan degradation
bpw00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    WESB_2245
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    WESB_2245
Enzymes [BR:bpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     WESB_2245
Bacterial toxins [BR:bpw02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   WESB_2245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: CCG57707
UniProt: K0JKU9
LinkDB All DBs
Position
complement(2487204..2488613)
Genome map
AA seq 469 aa AA seqDB search
MSKLKLFLILASALLISCANPNDPGDDGTGGGGTGTGGGTNKAGYVFPKGSLSQEEQQKD
LDPDSTMKVLFEKNDPKIGSKFFRIPALVVTKKGTIIAAADRRYDTPTDLGKGGIIDVVV
KTSSDMGNTWSDAITVLKATDSKSSYGDAFLMNAHDGSVLMGVVAEPGVQNKADTWIFKS
TDEGKTWAKIATLGTGSALYKDGTANRGFGASGQGLTLRYGQNKGKLMFAFFQWNSASGG
SGLSVSSIMSSDNGASWTKTGSIKPDRPDNNIDETKAIELSDGTILLNHRRSVSKGGRSW
SKSTDGGQNWTSEGLDPEVNDPGNNADFARYEFYGRPVKTSEYILMINSDGTANGTWFFN
RKRHTIRLTENEFNNGNPTQAGKYAYTKMLAKDGATRYSGYPTISVLPDGSIITLTEEET
ATERPAGGQFGAGGDDYDIIFRRFNLYWLSDGKEYVDYSKDALFQQPNP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttaaaactatttttgatattggcatctgcattgctgatatcatgtgctaat
ccaaacgacccaggtgatgacggcacaggcggcggaggaacaggtacaggcggaggtact
aataaagctggctatgtgtttccaaaaggttctttaagccaagaagaacagcaaaaagat
ttagatccagatagtacaatgaaagtattgtttgaaaaaaatgatccaaaaataggctct
aaattttttagaattcctgcacttgttgttactaaaaaaggcacaataatagctgctgct
gatagaagatacgatactcctacagatttaggaaaaggtggaattattgatgttgttgta
aaaacaagctctgatatgggtaatacttggtctgatgctataactgtattaaaagcaact
gattcaaaatcatcttatggagatgcctttttaatgaatgcccatgatggttctgtatta
atgggagttgttgctgagcctggagtacaaaataaagctgatacttggatattcaaatct
actgatgaaggtaaaacttgggctaaaatagctactttgggaacaggtagtgctttatat
aaagatggtacagctaatagaggatttggagcatcaggacaaggattaacattaagatac
ggtcaaaataaaggaaaattaatgttcgctttcttccaatggaatagtgctagtggtggc
agcggattatcagtatcttctataatgtcatcagataatggagcaagttggactaaaaca
ggctctataaaacctgatagacctgataataatatagatgaaactaaagctatagagctt
tctgacggtacaattttattaaatcatagaagaagtgttagtaaaggtggaagaagttgg
tctaaatctactgatggcggtcaaaattggacttctgaaggattagatcctgaagttaat
gacccaggtaataatgctgattttgctagatatgaattctatggaagacctgtaaaaaca
tctgaatatatattaatgattaactcagatggtacagctaatggaacttggttctttaac
agaaaaagacatactattagacttacagaaaatgaatttaataatggaaatcctactcaa
gctggaaaatatgcttatactaagatgttagcaaaagacggagcaacacgttattctgga
tatcctacaataagtgttttacctgatggaagtataattactttaacagaagaagaaaca
gctactgaaagacctgcaggtggtcaatttggagcaggcggtgatgattatgatattata
tttagaagattcaatttatattggttatctgatggtaaagaatatgtagattattctaaa
gatgcattattccaacagccaaatccataa

DBGET integrated database retrieval system