KEGG   Paraburkholderia phytofirmans: Bphyt_7159Help
Entry
Bphyt_7159        CDS       T00765                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bphyt_7159
Enzymes [BR:bpy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bphyt_7159
Transporters [BR:bpy02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bphyt_7159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2:complement(3551577..3552254)
Genome map
AA seq 225 aa AA seqDB search
MLIVHHLNNSRSQRVLWLLEELGVPYEIKRYQRDPKTMLAPPELRAVHPLGKSPVIADDG
QTIAESGAIVEYLIGKYGQGRFAPAPDTPERLRYTYWLHYAEGSAMPPLLLKLVALRIAS
APMPFFAKPIARKIAGTLQSSFIDPQLKLHLGYINQELSKTGWFVGNDFTAADVQMSFPL
EAGTARGGMEGQIPAVVEFLKRIHARPAYQRALERGGKYELLGGD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgtccatcatctgaacaactcccgctcgcagcgtgtactgtggctgctcgaa
gaactcggcgttccttacgagatcaagcgttaccagcgcgatccgaagaccatgctcgcg
ccgcccgagttgcgcgcggtgcatccgctcggcaagtcgcccgtgattgccgacgacggc
cagacgatcgccgagtcgggcgcgatcgtcgagtatctgatcggcaaatacgggcaggga
cgttttgcgccggcacctgacacaccggagcggctgcgctacacgtactggttgcactac
gctgaaggttcggcgatgccgccgctgttgctcaagctcgtggcgctgcggattgccagc
gcgccgatgccgttcttcgccaagccgattgcgcgcaagattgccggcacgctgcaatcg
agtttcatcgatccgcaattgaaactgcacctcggttatatcaatcaggagttgagcaag
accggctggttcgtcggcaacgacttcacggcggcggacgtgcagatgagtttcccgctc
gaagccggcacggcgcgcggcggcatggaaggccagattccggcggtggtcgagttcctg
aagcgcattcatgcgaggccggcgtatcaacgcgcgctagagcgtggcggcaagtacgaa
ttgctcggcggcgattga

DBGET integrated database retrieval system