KEGG   Bradyrhizobium sp. ORS 278: BRADO1419Help
Entry
BRADO1419         CDS       T00516                                 

Gene name
gst1
Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRADO1419 (gst1)
Enzymes [BR:bra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRADO1419 (gst1)
Transporters [BR:bra02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRADO1419 (gst1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
1517335..1517979
Genome map
AA seq 214 aa AA seqDB search
MTADDRITLYYSPQTRAAGARVLLEELGAPYDLHVLNMKAGEQRKPEFLAINPLGKVPTV
GHRGAIVTEQVAIFIYLADLFPQAGLTPALDDPMRGPYLRWIAYYGSSFEPALIDRFMKR
EPAPVTQSPYADYDTMLGALEQQLAKGPYLLGERLTAADILWGIALNWTMMFGIVPRKEV
FTRYAERITSRPAFQRVTAADADMAAQHEAAVSG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgacgacaggatcacattgtattattcgccgcagacccgcgccgccggcgcc
cgcgtgctgctcgaggaactcggcgcgccctatgaccttcatgttctgaacatgaaggcc
ggcgagcagcgcaagccggaattcctcgcgatcaacccgctgggcaaggtgccgaccgtc
ggccatcgcggcgcgatcgtcaccgagcaggtcgcgatcttcatctatctcgccgacctc
ttcccgcaagccggcctgacgccagcgctcgacgatcccatgcgcggaccgtatctgcgc
tggatcgcttactatggctcgtcgttcgagccggcgctgatcgatcgtttcatgaagcgc
gagccggcgccggtcacgcagtctccctacgccgattatgacacgatgctcggcgcgctg
gagcagcagctcgcgaagggaccctacctgctcggcgagcgtctgactgccgccgacatc
ctctggggcatcgcgctgaactggaccatgatgttcggcatcgtgccgcgcaaggaggtg
ttcacccgctacgccgaacgcatcacctcacgaccggcgttccagcgcgtcaccgcagcg
gatgccgacatggctgcgcagcatgaagcggcggttagcggctga

DBGET integrated database retrieval system