KEGG   Bradyrhizobium sp. ORS 278: BRADO5816Help
Entry
BRADO5816         CDS       T00516                                 

Definition
(GenBank) putative trehalose synthase (Maltose alpha-D-glucosyltransferase)(treS-like)
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00500  Starch and sucrose metabolism
bra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRADO5816
Enzymes [BR:bra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BRADO5816
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BRADO5816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: CAL79480
RhizoBase: BRADO5816
UniProt: A4Z004
LinkDB All DBs
Position
6025101..6028406
Genome map
AA seq 1101 aa AA seqDB search
MNVMSSLDAPSLQTETDGDGLWYKDAIIYQLHVKAFADSNNDGIGDFAGLTEKLDYLQDL
GVTALWLLPFYPSPGRDDGYDIADYGSINPDFGTMKEFKRFIQEAQRRGLRVITELVVNH
TSDQHHWFKRARRSPPGSSARNWYVWSDTDQKYLGTRIIFTDTEKSNWTWDPEAGQFYWH
RFFSHQPDLNFDNPRVVSAIIQVMKRWLDAGVDGFRLDAIPYLCERDGTNNENLPETHAI
IKRLRVELDNYAKDKLLLAEANQWPEDVQEYFGQGDECHMAYHFPLMPRIYMAIAQEDRF
PITDILRQTPDIPASCQWALFLRNHDELTLEMVTDVERDYLWSTYANDPRARINVGIRRR
LAPLMDNDRRKIELMNSLLMSFPGTPIIYYGDEIGMGDNIYLGDRNGVRTPMQWTPDRNG
GFSRADPARLYAPMIMDPVYGYEAVNVEAQSRSLSSLLNATKKLISVRKSTLAFGRGTMT
FIRPANRSVLAYVRQYKDEVILCVANLSRSAQATELDLSAFKDRIPVEMLGRSRFPAIGE
LPYMITLSPYSFYWFQLKERDKSEPVVQRAVPEFETLVVPLGSTWVSLARTRSLFERDVL
PGHLARTRWYPERTPDAIHPTLTSAIPFCDIGDNRPWLIFFKAAERKDEMRYLLPMQIDW
VRFDRERYNPQAFAAVRQGAREGTLLDAATNPIFLSLLLRNLAQSLTVEENGLRLEFRPT
SRFPDKPVRESEQVRVIETDRCSSKAVVNNEFFIKIYRELEAGPHPEVEFGRFLTESVQF
SNVPPLLGSVELVQDDERRTVGAVHGFVENQGDGWTVTAAYLDRYIDDQRVFATSGDERQ
SEELSPYLRYMAQTGRRTGELHAALASRGDIPGFAPEPTTADSLDHWIDRLRAQAVRIVA
SLSERHDHLKDPERGLADQVLARRSELSERLGHLLPYQMDGCDIRVHGDFHLGQILIVRD
DIVIIDFDGDEGLPLAERWRKAPPARDIAGFLRSIDCSVRVALERALRASPDDHGRLAAA
LTEWRDRAIAAFLAGYHEVKATEPLWPENSRSAEALLNFFLLEKALGALEYDLAHRPDWL
RVALGNLLRVLSESAPSSESS
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgatgtcatccctggacgccccgagcctccagaccgagaccgatggcgacggc
ctctggtacaaggacgcgatcatctaccagttgcacgtcaaggcattcgccgacagcaac
aatgacggcatcggcgattttgccggcctcaccgagaagctcgattatctgcaggatctt
ggcgtcaccgcgctgtggctgctgccgttctatccctcgcccggccgcgacgacggttac
gacatcgccgactatggcagcatcaatcccgatttcgggacgatgaaggagttcaagcgc
ttcatccaggaggcgcagcgccgcggcctgcgcgtcatcaccgagctcgtggtcaaccac
acctccgaccagcaccattggttcaagcgcgcgcgccgcagcccgccgggatcgagcgcg
cgcaactggtatgtctggagcgataccgaccagaaatatcttggcacgcgcatcatcttc
accgacaccgagaagtcgaactggacctgggatccggaagccggccagttctactggcat
cgattcttctcacatcagccggatctcaatttcgacaatccgcgcgtggtcagcgccatc
atccaggtgatgaagcgctggctggatgccggcgtcgacggcttccgcctcgacgcgatc
ccctatctctgcgagcgcgacggcaccaacaacgagaatctgcccgagacgcatgcgatc
atcaagcgcctgcgcgtcgagctcgataactacgccaaggacaagctgctgctggcggag
gccaaccaatggccggaggacgtgcaggaatatttcggccagggcgacgagtgccacatg
gcctatcacttcccgctcatgccgcgcatctacatggcgatcgcgcaggaggaccgcttc
ccgatcaccgacatcctgcgccagacgccggacatccctgcgagctgccaatgggcgctg
ttcctgcgcaatcatgacgagctgacgctcgaaatggtgaccgacgtcgagcgcgactat
ctctggtcgacctacgccaacgatccacgcgcgcgtatcaatgtcggcatccgccggcgg
ctggcgccgctgatggacaatgaccggcgcaagatcgagctgatgaactcgctcctgatg
tcgttcccgggcacgccgatcatctattacggcgacgagatcggcatgggcgacaacatc
tatcttggcgaccgcaacggcgtgcgcaccccgatgcaatggacgccggaccgcaatggc
ggcttctcgcgcgccgacccggcgcggctgtacgcgccgatgatcatggacccggtctac
ggctacgaggcggtcaacgtcgaggcgcagtcacgcagcctgtcgtcgctcctcaacgcc
acgaagaagctgatctcggtgcgcaagtcgacgctcgccttcggccggggcacgatgacg
ttcatccgtccggccaaccgctccgtgctggcctatgtgcggcaatacaaggacgaggtc
attctctgcgtcgccaatttgtcgcgctcggcgcaggcgaccgagctcgatctctccgca
ttcaaggaccgcattccggtcgagatgctcggccgctcgcgctttcccgccatcggcgag
ctgccctacatgatcacgctgtcgccctatagcttctactggttccagctcaaggagcgt
gacaagtcggagccggtggttcagcgcgccgtaccggaattcgagacgctggtggtgccg
ctcggctcgacctgggtgtcgctggcgcgcactcgcagcctgttcgagcgcgacgtgctg
cccggccatctcgcgcgcacgcgctggtatcccgaacgcacgccagacgcgatccacccg
actttgacgtccgcgatcccattttgcgacatcggcgacaaccgtccgtggctgatcttc
ttcaaggccgccgagcgcaaggacgagatgcgctacctgctaccgatgcagatcgactgg
gtgcggttcgatcgcgagcgctacaatccgcaggcgttcgccgccgtgcgccagggcgcc
cgcgagggcacgctgctcgatgccgccaccaatccgatattcctgtcgctgctgctgcgc
aatctcgcgcagtcgctcaccgtcgaggagaacgggctgcggctggaattccgcccgacc
tcgcgctttcccgacaagccggtgcgcgagtccgagcaggtgcgcgtcatcgagaccgac
cgctgcagcagcaaggccgtcgtcaacaacgagttcttcatcaagatctatcgcgagctc
gaggccggccctcatccggaagtcgagttcggccgcttcctcaccgagagcgtccagttc
tccaacgtgccaccgctgctcggcagcgtcgagctggtccaggacgacgagcgccgcacg
gtgggcgccgtgcacggcttcgtggagaatcagggcgacggctggaccgtcaccgcggcc
tatctcgaccgctacatcgacgaccagcgcgtgttcgccacgagcggcgacgaacgacag
agcgaggagctttcaccctatctgcgctacatggcccagaccggccgacgcaccggggag
ttgcatgcagccctggcctcgcgcggcgacatccccggcttcgctcccgagccgaccacg
gccgatagcctcgatcactggatcgaccggcttcgggcccaggccgtgcggatcgtcgcc
agcctgagcgagcgccacgatcatctcaaggaccccgagcgcggtttggccgatcaggtc
ctcgcgaggcgaagtgaactgtcggagagactgggtcatcttcttccctaccagatggac
ggctgcgatatccgcgtgcatggcgactttcacctgggtcagatcctgatcgtcagggac
gacatcgtcatcatcgacttcgacggcgacgaagggctgccgcttgccgagcgctggcgc
aaggcgccgccggcgcgcgacatcgcgggcttcctgcgctcgatcgactgctccgtgcgc
gtggcgctcgaacgcgcgctgcgggccagccccgatgaccatggccggctcgctgccgcg
ctgacggaatggcgcgatcgcgccattgcggcctttctggccggttatcacgaggtgaag
gccacggagccgctctggccggagaattcgcgcagcgcagaggcgctccttaactttttc
ctgctggaaaaagcgctcggagcgctcgaatatgatctggctcaccggccggactggttg
cgcgtcgcgctgggcaatctgcttcgcgtcctgtccgagtcagccccttccagcgagtct
tcatga

DBGET integrated database retrieval system