KEGG   Bradyrhizobium sp. BF49: BF49_3871Help
Entry
BF49_3871         CDS       T04337                                 

Definition
(GenBank) ATPdependent DNA ligase EC 6511
Organism
brad  Bradyrhizobium sp. BF49
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:3980508..3981455
Genome map
AA seq 315 aa AA seqDB search
MARKSTLPYRLQPMLASLTDAPFDDPDWVFEDKFDGFRMVAEIRRGRVALYSRNGKIISH
SYVEVAKALEGVKADAVIDGELVAIGKDGVSHFQLLQNALRHEAKLLYCAFDLMFAAGED
LRALPLLERKKRLKALLPRHKLIAFSNHRKDSGTKFFAQAELRHLEGIMAKRADSPYASG
RRTADWLKVKTAQRQEVVIAGFTAPRRTRPFFGALVLAVRDADAWRYIGHVGTGFSHQVL
EELHRKLVRLKTAKSPFPGKVKNERVTTWVRPSLVAEVKFAEWTSKGELRQPVYLGLRSD
KNAKDVVREKKWSRK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaaatcgaccctgccttatcgcctgcagcccatgttggcctcgctcacggat
gcgccgttcgacgatcccgattgggtcttcgaggacaaattcgatggtttccgcatggtc
gcggaaatccggcgtggtcgggtcgcgctctacagccgcaacgggaagatcatcagccac
tcctatgtcgaggtcgcgaaagcacttgagggagtgaaggcggacgccgtgatcgatggc
gagctcgttgcgatcgggaaggacggcgtatcccatttccagttgcttcaaaacgctctg
cgtcacgaggccaagcttttgtactgcgcgttcgacctcatgttcgcagcgggcgaggac
ctgcgtgcgctgccgcttctcgagcgcaagaagcggctcaaggccctcttgccgcgccac
aagctcatcgcgttcagcaaccaccgcaaagacagcggcacaaagttctttgcacaagcc
gagctgagacatctcgaaggcatcatggccaagcgcgccgacagcccgtacgcgtccgga
cgccggaccgccgattggctgaaggtgaagaccgcgcagcggcaggaggtagtgatcgcc
ggcttcaccgcgccgaggcgaacccggcccttcttcggggccctcgtgctggcggtacgc
gacgccgatgcatggcggtacattggccacgtcggcaccggcttcagccaccaggttctc
gaagagcttcaccgcaagctcgtgaggctgaagacagccaagtcgcccttccctggcaag
gtgaaaaatgagcgggttacgacctgggtgcgtccttccttggtcgcggaagtgaaattc
gcggagtggaccagcaagggcgagctgcgccagccggtctatctcggcctgaggtccgac
aaaaacgccaaggacgtcgttcgcgaaaagaagtggtcgcgaaaataa

DBGET integrated database retrieval system