KEGG   Bradyrhizobium sp. BF49: BF49_4877Help
Entry
BF49_4877         CDS       T04337                                 

Definition
(GenBank) ATPdependent DNA ligase EC 6511 clustered with Ku protein LigD
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:brad00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BF49_4877
Enzymes [BR:brad01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BF49_4877
DNA repair and recombination proteins [BR:brad03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BF49_4877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:5020871..5023582
Genome map
AA seq 903 aa AA seqDB search
MPKENPGPVVLQKLSKYRQKRDFEKTPEPSGKTAVAPSKQRRFVIQKHDATRLHYDLRLE
FDGVFKSWAVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPEGQYGGGTVMLWDRGTWE
SEDPERGFKKGDLKFTLHGEKLHGSWVLVRMRNDRTGGKRTNWLLIKHRDEYVREGADND
ILEEDKSVASGRAMDQIAEGKGRAPKPFMLAKGTKAKADAVWQSNRADEAKERTVKPAPR
AALKTGKTAKKKATTATTAKKAEMPDFVAPQLCTSVERPPGGDGWCHEIKFDGYRVQLRV
EGGKATLKTRKGLDWTGKFASIAKEAGVLPDMMIDGEIVALDHNGAPNFSSLQAALSDGK
TDELIFFAFDLLFAEGLDLRPLPLGERKDRLKELLEARKKKSSQIRYVEHFESGGDAVLQ
SACKLELEGVVSKKLDAPYRSGRTESWTKAKCRAGHEVVIGGYKTTNGKFRSLMAGVHRG
DHLAFVGMVGTGFGADKVKRIMPSLKAMEAKQSPFGGKNAPKKAREVHWLKPELVAEIEF
AGFTADGNIRQAAFKGLRQDKPAAEVEAETPVDTELAEPSTKQRAKAKTGARTAQAGGSA
EVMGVVISKPDKELWPDDGNGDPVTKLDLARYLEAVGEWMIVHLKGRPCSLIRAPDGIKG
ECFFQRHAMQGTSNLLELARVSGDRKPYLQIDRIEGLAAVAQIGGVELHPWNCAPYAYDT
PGRLVFDLDPAPDVVFAEVVEAAKEMRQRLTDIGMESFCKTTGGKGLHVVVPLRHGARDQ
VSWKEAKAFAQGVCQWMADDDPERYLLNMSKKLRTGKIFLDYLRNDRMSTAVAPLSPRAR
DGATVSMPVTWAQVKSDLDPKRYTVRKVPGLLARSKAWDGYDDAAASIKAAIKKLAAKKS
RVG
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaaagagaatccgggaccagtcgtgctgcaaaagctctccaagtatcgacagaaa
cgtgatttcgagaagacgccggagccgtcgggcaagaccgcggtggcgccgtcgaagcag
cggcgcttcgtgatccagaaacatgacgccacgcggctgcactacgatctgcggctcgag
ttcgacggcgtcttcaagtcctgggcggtgacgaaaggaccctcgctcgatccgcacgac
aagcggctggccgtcgaggtcgaggaccacccgctcgactatggcgacttcgagggcacg
attccggagggccagtacggcggcggcacggtcatgctgtgggaccgcggcacctgggaa
tctgaggatcccgaacgcggtttcaagaagggcgatctgaagttcaccctgcatggcgag
aagctgcacggcagctgggtcctggtgcgcatgcgcaacgaccgcaccggcggcaaacgg
accaattggctcttgatcaagcatcgcgacgaatatgttcgcgagggcgcagacaacgac
attctcgaggaggacaaatcggtcgcctccggccgcgcgatggatcagatcgccgaaggc
aaggggcgagcaccaaaaccgttcatgctggcgaagggcaccaaggccaaggccgacgcg
gtctggcagtccaaccgggcggacgaggcgaaagagcgcacggtcaagccggcaccccgc
gcggcgttgaagaccggcaagacggcaaagaagaaagcaacaaccgcgacgaccgcgaag
aaggcggagatgccggatttcgtcgcgccgcagctctgcacctcggtcgagcgcccgccg
ggcggcgatggctggtgccacgagatcaagttcgacggctaccgcgtgcagctgcgggtc
gagggcggcaaggcgacgctgaagacgcgcaaaggcctcgactggaccggaaaattcgca
agcatcgcgaaggaagcgggcgtgttgccggatatgatgatcgacggcgagatcgtcgcg
ctcgaccataatggggcaccgaacttttcgtcgcttcaggccgcgctgtcggacggcaag
accgacgagctcatctttttcgccttcgacctcctgttcgccgaagggctcgatttgcgg
ccgctgccgctcggggagcgcaaggaccgcctcaaggagctcctggaggcacgcaagaag
aaatcaagccagatccgctatgtcgagcatttcgaaagcggcggcgacgcggtgctgcaa
tcggcctgcaagctcgagctcgagggcgtggtgtcgaagaagctcgatgcgccttatcgt
tcggggcggacagaaagctggaccaaggccaaatgccgcgccggccatgaggtcgtgatc
ggcggctacaagaccaccaatggcaaattccgttcgctgatggccggcgtgcaccgcggc
gatcatctcgccttcgtcggcatggtcggcaccggcttcggcgcggacaaggtcaagcgc
atcatgccgtccttgaaggccatggaggccaagcaaagccccttcggcggcaagaacgca
ccgaaaaaggcgcgcgaggtgcactggctgaagccggagctcgtggcggagatcgagttc
gccggcttcaccgccgacggcaatatccgccaggccgccttcaagggtctgcggcaggac
aagccggcggcggaggtcgaggccgagacaccggtcgataccgagcttgccgagccctcg
acgaagcagcgcgcgaaagcgaagaccggcgcgcgaacggcccaggccggcggcagtgcc
gaagtgatgggagtcgtcatttccaagccggacaaggagctctggccggacgacggcaat
ggcgatcccgtcaccaagctggatctcgcgcgctatctcgaagccgtcggcgaatggatg
atcgtccacctgaagggccgtccgtgctcgctgatccgcgcccctgacggcatcaagggc
gaatgcttcttccagcgccacgccatgcagggcacctcgaaccttctggagctcgcgcgg
gtctccggcgaccgcaagccctatttgcagatcgaccgcatcgaagggctcgccgccgtg
gcgcagattggcggcgtcgagctgcatccctggaattgcgcgccctacgcctacgatacc
ccgggccggctggtgttcgatctcgatccggcgcccgacgtcgtcttcgccgaggtcgtc
gaggccgccaaggagatgcggcagcggctgaccgacatcggcatggaaagcttctgcaag
accaccggcggcaagggcctgcacgtcgtggtaccgctgcgtcatggcgcccgcgatcag
gtgagctggaaagaggcgaaggccttcgcgcaaggcgtttgccagtggatggcggacgac
gatcccgagcgctatctgctcaacatgtcgaagaagctgcgaacgggaaagatcttcctg
gactatttgcgcaacgatcgcatgtcgacggcggtggccccgctgtccccccgcgcgcgc
gatggtgcgactgtgtcgatgccggtcacgtgggctcaggtgaagagcgaccttgatccg
aagcggtacacggtacgaaaggtgccgggcttgctggcgcgatcgaaggcgtgggatggc
tacgacgatgcagccgcgtcgatcaaggcggcgatcaagaagctcgcggcgaaaaagagt
agggtgggttag

DBGET integrated database retrieval system