KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_09500Help
Entry
BCCGELA001_09500  CDS       T04273                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCCGELA001_09500
Enzymes [BR:brc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BCCGELA001_09500
Transporters [BR:brc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BCCGELA001_09500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2004263..2004919
Genome map
AA seq 218 aa AA seqDB search
MAKATLTISSKNYSSWSLRGWLLTKFSGLDFEEIVTAPDDASARAEILLLSSSILVPCLR
HEGAVIWDTLAIAEYLNEAMPDAGLLPDDRIQRAHCRSISGEIHSGFTTLRASLPVNLKG
HFPGFKIWSRAQADIDRVWFIWRDCLEKSGGPFLFGEKRTMADAMYAPVVTRFVTYDVKL
APPLKAYADTIMAMPEMQEWIAAAREEPAEIEELEVEY
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgacactgaccatcagcagcaagaattattcgtcctggtcgctgcgtggc
tggctgctgacgaagttctccgggcttgatttcgaggagatcgtcacggcgcccgacgac
gcatccgcccgcgccgaaatccttctgttgtcgtcctctatcctggtgccctgcctgcgg
cacgagggcgccgtgatctgggatacgctggcgatcgccgaatatctcaatgaggcgatg
ccggacgccggtctattgcctgatgaccgcatccagcgcgcgcattgccgctcgatctcg
ggcgaaatccattccggcttcaccacgttgcgcgcctcgcttccggtcaatctgaagggg
cactttcccggcttcaagatctggtcgcgcgcgcaggccgacatcgaccgcgtctggttc
atctggcgtgattgcctggaaaagtcgggcggccccttcctgttcggcgagaagcgcacc
atggcggatgcgatgtacgcgcctgtggtgacgcgcttcgtcacctatgacgtcaagctc
gcgccgccgctgaaggcctatgccgacaccatcatggccatgcccgagatgcaggaatgg
atcgcggccgcgcgggaagagccggccgagatcgaggagctcgaggtcgaatattag

DBGET integrated database retrieval system