KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_13230Help
Entry
A4249_13230       CDS       T04395                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Brite
Enzymes [BR:brg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     A4249_13230
Peptidases [BR:brg01002]
 Metallo Peptidases
  Family M2
   A4249_13230
Exosome [BR:brg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4249_13230
CD molecules [BR:brg04090]
 Proteins
  A4249_13230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2664628..2666523
Genome map
AA seq 631 aa AA seqDB search
MKRQMMTAVAVCALAFAAGCASTSEPAAGAPGVEQTASTTPAPAVSGMRADYPITAEGAT
AFIADAETKWAEVSEYVARIQWARATNITFDTMWLESKANAEATELQVQLANQAAKFNDV
QVDPVVRRKLNLLRLSLVLPAPNRPGAADELAQITTRLDSTYSTGKFDFKGKPITLDEAS
LILADSRDPAETKALYEGWRTISPVMRDDYARMVEIANEGSRELGFADTGALWRSGYDMP
ADDFAAETDRLWAQVKPFYENLHCYVRARLNAKYGDAVQPDHGPIRADLLGNMWSQQWGN
IYDVVAPPSGGASSYDLTELLKAADYDATKMVKTGEGFYVSLGLDPLPQTFWERSQITRP
RDREVVCHASAWDLDNADDIRIKMCTNVNGDDFYTVHHELGHNYYQRAYKNQPMLFRNGA
NDGFHEAIGDFVGLSALTPTYLNQIGLLKTTPGAEEDIPFLLKMALDKIAFLPFGLMVDR
WRWDVFSGETAPAAYNTAWTADMLQYQGLVPPGQRPANAFDPGAKYHVPGNTPYTRYFLA
AIYQFQFQRAACKQAGWTGPLHRCSVYGNKEVGARFNAMLQMGQSQPWQEAMKAFTGDDG
NDASAIADYFAPLNVWLQEQNRGHQCGWSAA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtcagatgatgaccgccgtcgcggtctgcgccctcgccttcgccgccggctgc
gccagcaccagcgaacccgccgccggcgcgccgggcgtcgaacagacggcctcgacgacg
cccgcgccggccgtcagcggcatgcgcgccgactatccgatcaccgccgagggtgcgacg
gcctttatcgccgacgccgaaaccaaatgggccgaggtcagcgaatatgtcgcccgaatc
caatgggcgcgcgccaccaacatcaccttcgacacgatgtggctggaatccaaggctaac
gccgaggcgaccgagcttcaggtccagctggccaatcaggcggccaagttcaacgacgtc
caggtcgatccggtcgtgcgccgcaagctgaatctgctgcgactcagcctggttctgccc
gcgcccaaccgtcccggcgcggccgacgagctggcccagatcacgacgcggctggactcg
acctattcgaccggcaagttcgatttcaagggcaagccgatcaccctggacgaagcctcg
ctgatcctggccgacagccgcgatcccgccgagaccaaggcgctttatgaaggctggcgc
accatctcgccggtcatgcgcgacgactacgcccgcatggtcgagatcgccaatgagggc
tcgcgtgagttgggcttcgccgacaccggcgccctgtggcggtcaggctacgacatgccc
gccgacgatttcgccgccgagaccgatcggctgtgggcccaggtgaagcccttctacgag
aacctgcactgctatgtgcgcgccaggctgaacgccaaatacggcgacgcggtccagccc
gaccacggcccgatccgcgccgatctgttgggcaatatgtggtcccaacagtggggcaac
atctatgatgtggttgccccgcccagcggcggcgcctcaagctacgacctcaccgaactg
ctgaaggccgccgactacgacgcgaccaagatggtcaagacgggcgagggcttctacgtc
tcgctgggcctcgacccgctgcctcagaccttctgggaacgcagccagatcacccgcccg
cgcgaccgcgaagtcgtctgtcacgcctcggcctgggacctggacaacgccgacgacatc
cgcatcaagatgtgcaccaacgtaaacggcgacgacttctacaccgtccaccacgaactg
ggtcacaactactatcagcgcgcctacaagaaccagccgatgctgttccgcaacggcgcg
aacgacggcttccacgaagccatcggcgacttcgtcggcctgtcggccctgacccccact
tatctgaaccagatcggcctgctcaagacgacgccgggcgcagaggaggacatccccttc
ctgctcaagatggccttggacaagatcgccttcctgccgttcggcctgatggtcgaccgc
tggcgctgggacgtcttctcaggcgagacggcgccggccgcctacaataccgcctggacc
gccgacatgctgcaataccagggtctggttccgcctggacagcgcccggccaacgccttc
gatccgggcgccaaataccatgtgcccggaaacacgccgtatacccgctacttcctggcg
gccatctatcagttccagttccagcgcgcggcctgcaaacaggccggctggaccgggccg
ctgcatcgttgctccgtttacggcaataaggaggtcggcgcccgcttcaacgccatgttg
cagatggggcagtcgcagccctggcaggaggcgatgaaggccttcaccggcgatgacggc
aacgacgcatcggccatcgccgactatttcgccccgctgaacgtctggctccaggaacag
aaccgcggtcaccagtgcggatggagcgccgcctga

DBGET integrated database retrieval system