KEGG   Brassica rapa (field mustard): 103856243Help
Entry
103856243         CDS       T03449                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
brp  Brassica rapa (field mustard)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    103856243
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103856243
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103856243
   00430 Taurine and hypotaurine metabolism
    103856243
Enzymes [BR:brp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103856243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
A3
AA seq 502 aa AA seqDB search
MVLSHAASDSDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGETETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPEQAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVLKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEK
TGRFNIVSKEEGVPLVAFSLKDSSSHTEFEISDMLRRYGWIVPAYTMPPNAQHITVLRVV
IREDFSRTLAERLVIDIEKVMRELDELPSRVIHKISLEEEKSEANGDNLMVTVKKTDMEK
QREIINGWKKFVSDRKKTNGIC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctctcacgccgcatcggattcggacgtctccgtccactccacattcgcgtca
cgatacgttcgaacttcacttcctaggttcaagatgccggaaaactcgattccaaaagaa
gcggcgtatcagataataaacgatgagttgatgcttgacggtaatccaaggctaaacttg
gcctccttcgtgaccacgtggatggagcctgagtgcgacaagctcatcatggcttccatt
aacaagaactatgtcgacatggacgagtaccctgtcaccaccgaacttcagaaccgatgt
gtgaacatgattgcacatctattcaacgcacctttaggagagacagagacagccgttgga
gtagggaccgttggatcatctgaggccataatgttggccggtttggcctttaagcgtaaa
tggcagaacaagcgtaaagcggaaggcaaaccttttgataaacccaacattgtcactgga
gctaatgttcaagtgtgttgggagaaattcgctaggtactttgaggttgagcttaaggaa
gtgaaactaagcgaagggtattatgtgatggacccggagcaagctgttgagatggtcgat
gagaacactatatgtgttgcggctattcttggttccactcttaatggagaatttgaagat
gtcaaactcttgaatgatctcttggtcctaaagaacaaagaaaccggatgggacacacca
atccatgtggatgcggcaagtggaggattcatagcaccgtttttgtatccagaattggaa
tgggactttagactgcctttggtgaagagtataaatgtgagtggtcacaagtatggactt
gtgtacgcaggaattggttgggtggtttggagaaacaaagaggatttgcccgaggaactc
atcttccatatcaattatcttggtgctgaccaacccacttttacgctcaatttctccaaa
ggttcgagtcaagtcatagctcaatactaccaactcattcgattgggccacgagggttat
agaaatgtgatggagaattgcagagagaatatgatcgtgttaagggaaggacttgagaag
acaggaaggttcaacatcgtatcaaaagaagagggagtaccgcttgtcgctttctccttg
aaagacagcagctctcacactgagttcgaaatctccgacatgcttcgcaggtacggatgg
atagtgccggcatatacaatgcctcctaacgcacaacacataactgttcttcgagtggtc
atcagagaagatttttcaagaacactcgcagagagacttgtgatcgatattgagaaagtg
atgcgtgagctcgatgagcttccttcacgagtaatccacaaaatttcgctggaagaggag
aagagtgaagctaacggcgataacttgatggtgacggtgaagaaaaccgatatggagaag
cagagagagatcatcaatggctggaagaagtttgtttccgacaggaagaagacaaatggt
atctgttaa

DBGET integrated database retrieval system