KEGG   Bradyrhizobium sp. S23321: S23_53960Help
Entry
S23_53960         CDS       T01796                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00630  Glyoxylate and dicarboxylate metabolism
brs00710  Carbon fixation in photosynthetic organisms
brs01100  Metabolic pathways
brs01120  Microbial metabolism in diverse environments
brs01200  Carbon metabolism
Module
brs_M00165  Reductive pentose phosphate cycle (Calvin cycle)
brs_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
brs_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    S23_53960 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    S23_53960 (cbbS)
Enzymes [BR:brs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     S23_53960 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAL78589
UniProt: I0GCV2
LinkDB All DBs
Position
complement(5554660..5555067)
Genome map
AA seq 135 aa AA seqDB search
MKLTQGCFSFLPDLTDDQITKQVQYCLANGWAVNIEFTDDPHPRNTYWEMWGLPMFDLQD
AAGVMMELAECRRVYGDRYIRISGFDSSHGWESVRISFLVNRPPQEAEFELVRQEIGGRA
IRYSTIRKNAAHAPQ
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacccagggttgcttctcgttcctgcctgacctcaccgacgaccagatcacc
aagcaggtgcagtactgcctggccaacggctgggcggtgaacatcgagttcaccgacgat
ccgcatccccgcaacacctattgggagatgtggggcctgccgatgttcgatctgcaggat
gccgccggcgtgatgatggagctcgccgaatgccgccgggtgtatggcgatcgttacatt
cgcatcagcgggttcgattccagccatggttgggagtcggtgcggatttcgttcctggtc
aaccggccaccgcaggaggcggaattcgagctggttcggcaggagatcggtgggcgcgcc
atccgctacagcaccatccgaaagaacgccgcgcacgcgccgcaatag

DBGET integrated database retrieval system