KEGG   Bipolaris sorokiniana: COCSADRAFT_123285Help
Entry
COCSADRAFT_123285 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bsc  Bipolaris sorokiniana
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bsc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    COCSADRAFT_123285
Enzymes [BR:bsc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     COCSADRAFT_123285
Chromosome [BR:bsc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     COCSADRAFT_123285
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    COCSADRAFT_123285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 520 aa AA seqDB search
MPSMVVIPSNGYTRRRVLVDRVHSIVSNRVEKDDEQYLVRWNTNNALDQAPLSWHSIKEL
LRCLEHVQDYLEVREKSMVSLEQVQPTTKKRKTPDSGLEDERRSSPFDPHLYHANHGGQT
PSFSQSPTATPPPSSPPDVYNGVIDADEHGYIFCHTSTGPDVPKIPIHSVPTPEMKQTAQ
RSSVDKALAYIRNEYIRRLSKVTGKDSKPIKLVNLVDSSTPSLRFRYISDYILQPGVIRA
PPETQTGCQSCSPHMGRDIGCEYTKKCDCLEYAAVDESRLDSTQQLQYQHALENGLSTMG
FPKKFPYYAAGTKRERTGCLVPFYLKSRSPIYECNDKCNCGRHCRNKNVQFGRQVEVEIF
RAADGRGWGLRCTEDLYEGQFIDTYRGEIITDAEAERRENASSSKAKASYLYSLDKFKES
EGLEDKDLYVVDGEFMGGPTKFINHSCDPNCRQYTVSYNRHDARVYDIAFFACRFIPRGE
ELTFDYLDKDEGEEDEMDEPGEGAIPCLCGTKKCRKWLWT
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccatggtcgtcataccatcaaatggctatacgaggcggcgcgtcctcgtcgat
cgcgttcactcgatagtctcaaatcgtgtggaaaaggatgatgaacaatacctagtccgg
tggaacaccaataatgcattggatcaagcgccgctgagctggcattcgatcaaagaactc
ttacgatgtctcgagcacgtgcaagattacctcgaagtgagagagaagtctatggtatca
cttgaacaagtgcaacctacaacaaaaaagcgcaaaacaccagacagtggcctggaggat
gaacgccgctcttcaccgtttgatcctcacctttaccatgcaaaccatggaggccagacg
ccgtctttctctcagtctccgacagcaacacctccaccttcatctccacccgatgtatac
aacggcgtcatagatgccgacgagcatgggtacatcttctgccatacgtccacaggacca
gacgtaccaaagatccctatccacagcgtcccaacaccagaaatgaagcagaccgcacaa
agatctagtgtcgacaaagcactagcctacatccgcaacgagtacatccgccgactatcc
aaagtcacaggcaaagacagcaagcccattaaactagtcaatctcgtagactcctccacc
ccctccctccgctttcgctacatatccgactacatcctccaaccgggcgtcatccgcgca
ccccccgagacccaaacaggctgccagtcatgctccccacacatgggccgggacatcggc
tgcgaatacacgaaaaaatgcgattgtcttgagtacgccgccgtcgacgaatcgcggctc
gactccacccagcaactacagtaccaacatgcgcttgagaacggtctctccaccatgggc
ttccccaaaaaattcccatactacgccgcaggcacaaagcgcgagcgcacggggtgcctc
gtccccttctacctcaagtcgcgcagccccatctacgaatgcaacgacaagtgcaactgc
gggcgccactgtcgcaacaaaaacgtgcagtttgggcggcaggttgaagtcgaaatcttc
cgtgctgccgacggccgcggttggggtctgcggtgtacggaggacctgtacgagggccag
ttcatcgatacgtaccgtggcgagattattaccgatgccgaagctgaacgccgagaaaat
gcttcttcgtcgaaagctaaggcttcgtacctttattccctcgataaattcaaggagtcg
gaggggctcgaggacaaggatttgtatgttgtggacggagaattcatggggggcccgacc
aagtttattaatcattcttgcgatcccaattgtcggcagtatacggttagttataatcgg
catgatgccagggtttacgatattgcattctttgcgtgtaggtttattccgaggggggag
gaactcacgtttgattatctggataaggatgagggggaggaggacgagatggatgagccg
ggggagggcgcgattccgtgtctttgtgggacgaagaagtgtaggaagtggttgtggacg
tga

DBGET integrated database retrieval system