KEGG   Bipolaris sorokiniana: COCSADRAFT_134319Help
Entry
COCSADRAFT_134319 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00250  Alanine, aspartate and glutamate metabolism
bsc00410  beta-Alanine metabolism
bsc00430  Taurine and hypotaurine metabolism
bsc00650  Butanoate metabolism
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
Module
bsc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bsc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    COCSADRAFT_134319
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCSADRAFT_134319
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCSADRAFT_134319
   00430 Taurine and hypotaurine metabolism
    COCSADRAFT_134319
Enzymes [BR:bsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     COCSADRAFT_134319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19130922
NCBI-ProteinID: XP_007696090
JGI: Cocsa1_134319
UniProt: M2RPH3
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MSSAPENTPLNRADEVKNLLDAIQELIIPFIRSADEDAATKHTGHGLRIEGSGGPRTTIV
EHHPPKKLESILSEDLEINDKKVGKDGLVKLVSTVLKYSVNTWDQGFLDKLYASTNAVGV
ASELLLAVLNTNAHVYHVSPVLTLVEKRTTKYLASLFGLPEKTCGGISQPGGSAANASAI
VIARNTLFPETKTDGNGTHKFTLFTSAHGHYSVEKAANIFGLGSKNVISVPVDDHGRMIP
SELERLVTESKTRGETPFFVNATAGTTVHGSFDPFTALSSICKSYNLWLHIDGSWGGSVI
FSSTYSPTRLTGAQLADSITVNPHKMLGVPMTSSFLLGRDMNTFYRALTLPAGYLFHHAP
STDAQDIYDLADLTPQCGRRADSLKFFLALQYYGPQHFSDLVDRAYDNAEYLLQKLKDSG
SFKTISPEPLPCLQVCFYYAKGGVVSEDSEVNSRATTEIAQRLVSRGFMIDFAPGEQGKF
FRVVVNGNVGRGTLDGLVKAIEDVAVELGL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcacctgaaaatacgcctcttaatcgggctgatgaagtcaaaaatcttctt
gatgccattcaggagttgattatcccgttcattcgctctgcagacgaagatgctgctact
aagcataccggtcatggtctgcgaatagaaggtagtggcggcccaagaactacaatcgtt
gagcatcatcctcccaagaagttggagtctattctcagcgaagatttggaaataaatgac
aaaaaagttggaaaagatggactggtcaagctggtgagcaccgtgttgaagtatagcgtc
aacacttgggatcaagggttcctggacaagttgtatgcgagtacgaatgcggtgggtgta
gccagtgaactgcttctggcggtgttgaacaccaatgcccacgtctaccacgtctcgccc
gtactaaccctcgtcgaaaaacgaacaacgaagtacctagcttctctttttggcctgcca
gagaaaacttgtggaggaatctctcaaccaggtggcagtgccgccaacgcctccgccatc
gttatcgctagaaacactctattcccagagaccaaaaccgacggcaatggaacccataaa
ttcaccctcttcacctcagcccatggccactactctgtcgaaaaagccgccaatatcttc
ggtctcggctccaaaaatgtcatctccgtccccgtcgacgaccatggccgcatgatcccc
tccgaactcgagcgcctcgtcactgaatccaagacccgcggcgaaacccccttcttcgtc
aacgccacagcaggcaccaccgtccacggctccttcgatcccttcactgccctctcctca
atctgcaaatcgtacaacctctggctccacatcgacggctcctggggcggcagcgtcatc
ttcagctctacgtactcccccacgcgtcttactggcgcccagctcgcagacagcataacc
gttaacccacacaaaatgctcggcgtccccatgaccagtagcttcttgctcggcagggac
atgaatacattttaccgcgcacttacgctccccgcgggctaccttttccaccacgccccc
agcacagatgcccaggatatatacgacctggctgacttgacaccccagtgcggtcgccgc
gcagacagcttaaagttttttctcgcactgcaatattatggtccgcagcatttcagcgac
ttggtagatagagcgtacgacaacgcggagtatctgctgcaaaaactcaaggatagtggc
agtttcaagacgattagtccggagccgctgccttgtctgcaggtgtgcttttactatgcc
aagggtggggtggtgagcgaggattcggaggtaaatagtagggctacgacggagattgcg
cagagactggtgagtagagggtttatgattgattttgcgcctggagagcaggggaagttc
tttagggttgtggtgaatggcaatgtggggagggggacgttggatggtttggtgaaggcg
attgaggatgtggcagtggaattggggttgtaa

DBGET integrated database retrieval system