KEGG   Bipolaris sorokiniana: COCSADRAFT_181272Help
Entry
COCSADRAFT_181272 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bsc  Bipolaris sorokiniana
Brite
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     COCSADRAFT_181272
Chromosome [BR:bsc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     COCSADRAFT_181272
   HDAC complexes
    Sin3A-HDAC complex
     COCSADRAFT_181272
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    COCSADRAFT_181272
  Chromatin remodeling factors
   NuRD complex
    COCSADRAFT_181272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MVDGNDMAGPTGAVHINTGTASQPKKVAYFYDSDVGNYAYVAGHPMKPHRIRMAHSLIMN
YGLYTKMEIYRAKPASKYEMTQFHTDEYIEFLHKVTPDNMEQFTREQSKYNVGDDCPVFD
GLFEFCGISAGGTMEGAARLNRGKCDVAVNWAGGLHHAKKSEASGFCYVNDIVLGIIELL
RYKQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGSGKNYSV
NFPLRDGITDETYRNIFEPVIEAVMTYYGPEAIVLQCGGDSLSGDRLGCFNLSMDGHANC
VRYVKSFGVPVIVLGGGGYTMRNVARTWAYETGELVSQKMSKQLPFNDYYEYFAPDYELD
VRPSNMENANSHDYLHKIKSAVIENIRRTGRPSVEAFTTIPDVPTALGRAMDSDAEDEED
DIDADENRDVRMTQRQRDKQIEHDGELYDASDDEDYKNSLGVRAQPGVKKRRNITDFPNP
NAAPADALDLMEDINGGSAVSTRQPSAGAKSRTQTPAAAEQEVDKDGDVDMDAPVPEAAP
EAVPEAAPEAAPETAPATAPPAVTETSDTAAPVAAPEREPSPAGVVTPPESPPTAVPATT
APTSAPVADVEMAETNDKEETVAAKEEGEAERDTENVKGEVRAEVAKD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggtggacggaaacgacatggcaggcccaactggcgctgtccacattaataccggcact
gcgtcgcagccaaagaaggtcgcatatttttacgattccgatgtcggtaactacgcctat
gttgcgggacaccccatgaagccgcatcgtatacgaatggcgcatagtctcattatgaat
tacggtctctacacaaagatggagatctaccgcgcaaaacccgcttctaagtacgagatg
acgcagttccacacggacgagtacattgaattcctgcataaggtcacgccagacaacatg
gagcaattcacccgcgagcaaagtaaatacaatgtgggagacgattgccctgtgtttgat
ggtctttttgagttttgcggtatcagcgctggcggtaccatggagggcgccgctcgtctg
aaccgggggaaatgcgatgtcgctgtaaactgggctggtggtttgcatcacgcgaaaaag
agcgaggccagtggattctgctatgtcaatgacattgtcctcggaattatcgagttgctt
aggtataagcagcgtgtactctacatcgacatcgacgtccatcacggagacggtgttgaa
gaggccttttacactaccgatcgtgtcatgaccgtctcattccacaaatacggagagtac
ttccccggtactggagaactccgcgacatcggtgttggtagtggcaagaattactctgtc
aacttccctcttcgagacggtatcaccgacgagacatacagaaatatctttgagcctgtc
atcgaggcagtaatgacttattatggacccgaagccatcgttctgcaatgcggtggtgac
agtctttcaggagacaggctcggttgcttcaatttgagcatggacggacacgccaactgt
gtcaggtacgtcaagagctttggtgtaccagtcatcgtcctaggaggcggtggttacacc
atgaggaatgtcgcgcgaacttgggcatacgagactggagagcttgtttcgcaaaaaatg
tccaagcaactacctttcaacgactactacgagtactttgcgcccgactacgaactggat
gtccggccatcaaacatggaaaacgccaactctcacgactatttgcataagatcaaatca
gctgtcattgagaacattcgcagaacgggacgaccatcggtcgaggctttcacaacgatc
ccagatgtgcccacggctctaggtcgcgcgatggattctgatgctgaggacgaagaagac
gatattgatgcggacgaaaaccgagatgtgcgcatgacacagcgccagcgcgataagcag
atcgagcatgacggtgaactttacgatgcaagcgatgatgaggattacaagaatagcctc
ggagtgcgcgctcagcccggcgtcaagaagagacgaaacattactgacttccccaatcct
aatgcagccccagctgacgccctggatcttatggaagacatcaatggcggaagcgctgtt
tcgacccgacaaccctctgcaggcgcaaaatcgcgtacacaaacacctgctgctgctgag
caggaggttgacaaagatggtgatgtcgacatggacgcacccgtccctgaagctgcccct
gaagctgttcccgaggccgcccccgaggctgcccctgagaccgcccccgctactgctcct
ccagccgttactgaaacctccgatactgccgctcctgttgctgcacctgagcgggaacca
tctcctgcaggcgttgtaaccccacctgagtcgccacccactgctgtgcctgctacaacg
gcacccacatcagccccagtcgctgatgtggaaatggccgaaactaatgataaggaagag
actgtcgcggcaaaagaggagggtgaagcggaacgcgacactgaaaacgtcaagggtgag
gtcagggcggaggtcgccaaggactag

DBGET integrated database retrieval system