KEGG   Blastococcus saxobsidens: BLASA_3098Help
Entry
BLASA_3098        CDS       T01752                                 

Gene name
LigD
Definition
(GenBank) DNA ligase D/DNA polymerase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bsd  Blastococcus saxobsidens
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BLASA_3098 (LigD)
Enzymes [BR:bsd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BLASA_3098 (LigD)
DNA repair and recombination proteins [BR:bsd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BLASA_3098 (LigD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2966028..2966999)
Genome map
AA seq 323 aa AA seqDB search
MVAPGPGEVPLPMLAVAGQLPSAGDAAWGYEFKWDGVRAVAAVRDGRLELRSRKGGDISV
RYPELAALPPGVDDPGTVVDGEIVVMDEAGRPDFGALQNRMHRTGPEVVRLAAARPVTYL
VFDLLAHGGRDLTGLPYAERRSLLDGLTPGGHRWVTTPWFRGGGERVQAASRENELEGVV
AKRLDSPYQPGARSPDWRKIKNVRAQSVVVGGWRPGAGRRTGTIGSLLFGVHDDAGRLVY
AGHVGTGFTDQALRDLQAVLSPRRTSPFAGALPREITRDAHWVEPELVGEVAFTGWTAEG
RLRHPSWRGLRADVDVADVVVEP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcccccggcccgggcgaggtcccgctgcccatgctggcggtcgcggggcagctc
ccgtcggccggggacgccgcctggggttacgagttcaagtgggacggcgtccgggcggtc
gccgctgtgcgggacggccggctggagctgcggtcccgcaagggcggtgacatctccgtg
cgctatcccgagctcgccgcgctgcccccgggggtggacgatccgggcacggtcgtcgac
ggcgagatcgtggtgatggacgaggcggggcggcccgacttcggcgcgctgcagaaccgc
atgcaccggacggggccggaggtcgtccggctcgccgcggcccgcccggtcacctacctc
gtcttcgacctgctcgcgcacggcggccgggacctcaccggcctgccctatgcggagcgg
cggtccctgctggacgggttgacgcccggcgggcaccgctgggtgaccactccgtggttc
cgcggcgggggcgagcgggtgcaggccgccagtcgggagaacgagctcgagggcgtcgtc
gccaagcggctcgactcgccctaccagcccggggcgcgcagccccgactggcgcaagatc
aagaacgtccgcgcgcagtcggtcgtcgtgggcgggtggcgccccggcgccgggcggcgg
acgggcacgatcggctcgctgctgttcggggtgcacgacgacgccggccgcctggtctac
gccgggcacgtgggcaccggcttcaccgaccaggcgctgcgcgacctgcaggcggtgctc
agtccccggcgcaccagtccgttcgccggcgcgctgccgcgggagatcacccgggacgcg
cactgggtggagccggagctggtcggcgaggtggccttcaccggctggacggcggagggg
cggctgcggcacccgtcgtggcgtggcctgcgggccgacgtcgacgtcgccgacgtggtg
gtggaaccgtga

DBGET integrated database retrieval system