KEGG   Brucella suis bv. 1: BSS2_II0875Help
Entry
BSS2_II0875       CDS       T03181                                 

Gene name
alr
Definition
(GenBank) alr
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
bsf  Brucella suis bv. 1
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSS2_II0875 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BSS2_II0875 (alr)
Enzymes [BR:bsf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSS2_II0875 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bsf01011]
 Precursor biosynthesis
  Racemase
   BSS2_II0875 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
II:908448..909638
Genome map
AA seq 396 aa AA seqDB search
MSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPA
FYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVE
NWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDE
PGNAANARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHD
FSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYA
DGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLED
VARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcatattgaccatt
gatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgccccaacccgt
acggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtcgcaccggct
ttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagcagtggcgctg
aagccctttttgaaacctgacgcaacactttatgtcctgaacggccttcagcccggaacg
gaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaacaggttgaa
aactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctccagttcgat
accggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttcttgagaacgtc
acgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaacggcgacgag
ccgggaaatgcggcaaatgcccgtcagcttgccaagatgacggccttgctcgctcgcctg
ccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaagacctattat
ttcgatctcgcccgccccggcatcgcgctatatggcatcgatccggagaggcagcatgac
ttttcggataaggtggcgcacgagaataagaaacccaagcattcgatccttcccgtcctc
accctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgacagttggctat
ggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtcggctatgct
gacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgatacgcgcctg
cccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctcattgccggag
ggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagcgcctcgaagac
gtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggcaaccgttat
gcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system