KEGG   Brucella canis HSK A52141: BCA52141_I0803Help
Entry
BCA52141_I0803    CDS       T01705                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bsk  Brucella canis HSK A52141
Brite
Enzymes [BR:bsk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BCA52141_I0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:complement(493064..493864)
Genome map
AA seq 266 aa AA seqDB search
MSAKDYLPHLAGISIIFHCLEAELRHCAIAARIVAAYVDCARKFCSCIRASSICFARRKL
KEKRRVSMAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLAGKSL
EEIVKESFGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRA
DFIAAGAGQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNA
RPKYLEAFVDSLVNWDYVLEMYEKAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaagactatctgccccatcttgctgggatttcaataatatttcattgcctt
gaagctgaattgcgccattgcgccattgccgcccgcattgttgcggcttatgtagattgc
gcacgcaagttttgctcttgcatccgggcatcatctatttgctttgcccgccgcaagctt
aaagaaaagaggagagtttccatggctttcgaactgcccgcccttccgtatgactatgat
gcgcttgcgcctttcatgtcgcgcgaaacgcttgaatatcatcacgacaagcatcatcag
gcctatgtcaccaacggtaacaagcttctcgaaggttccggcctggcaggcaagagcctc
gaagaaatcgtcaaggaaagcttcggcaagaatcaggccctcttcaacaatgccggccag
cactacaaccatatccatttctggaaatggatgaagaaggatggcggcggcaagaaactg
ccgggcaagctggaaaaggcctttgattccgatcttggcggttatgacaagttccgcgct
gatttcatcgctgccggtgccggccagttcggttcgggctgggcctggctttccgtcaag
gacggcaagcttgaaatttccaagaccccgaacggtgaaaacccgctcgtgcacggtgcg
gcgccgatcctcggcgtggatgtgtgggaacactcctattacatcgattaccgcaacgcg
cgtccgaaatatctcgaagctttcgtcgatagcctcgtgaactgggattacgtgctggaa
atgtacgaaaaggcggcataa

DBGET integrated database retrieval system