KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_01555Help
Entry
BSUW23_01555      CDS       T01302                                 

Gene name
amyE
Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSUW23_01555 (amyE)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BSUW23_01555 (amyE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
312276..314255
Genome map
AA seq 659 aa AA seqDB search
MFEKRFKTSLLPLFAGFLLLFHLVLGGSAAANAETQNTSKELTAPSIKSGTILHAWNWSF
NTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQPTSYQIGNRYLGTEQE
FKEMCAAAEEYGVKVIVDAVINHTTSDYAAISNEIKSIPNWTHGNTQIKNWSDRWDVTQN
SLLGLYDWNTQNAQVQSYLKRFLERALNDGADGFRFDAAKHIELPDDGNYGSQFWPNITN
TSAEFQYGEILQDSASRDAAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSVD
KLVTWVESHDTYANDEEESTWMSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSGLFEDQAITAVNRFHNVMDGQPEELSNPNGNNQIFMNQRGSHGVVLANAGSS
SVTINTSTKLPDGRYDNKAGNGSFQVTDGKLTGTLNARSVVVLYPDDIANAPHVFLENVK
TGVTHSFNDQLTITLRADANTTKAVYQINNGQETAFKDGDQLTIGKGDSFGTTYNITLTG
TNSDGVTRTQEYRFVKKDPSAAKTIGYQNPNHWGQVNAYIYKHDGGRAIELAGSWPGRAM
AKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQNQPGFDYVQNGLYNDSGLSGSLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaacgattcaaaacctctttactgccgttattcgctggatttttattgctg
tttcatttggttctgggagggtcggcggcagcgaatgctgaaacacagaacacatcgaaa
gagctgacagcgccatcgatcaaaagcgggaccattcttcatgcttggaattggtcgttc
aatacgttaaaacacaatatgaaggatattcatgatgcaggatatacagcgattcagacg
tctccgattaaccaagtgaaggaagggaatcaaggagataaaagcatgtcgaactggtac
tggttgtatcagccgacatcgtaccaaattggcaaccgttacctaggtactgaacaagaa
tttaaagaaatgtgtgcagccgctgaggaatatggcgtgaaggtcattgttgacgcggtc
atcaatcataccaccagtgactatgctgcgatttccaatgagattaagagtattccaaat
tggacacatggaaacacacaaattaaaaactggtccgatcgatgggatgtcacgcagaat
tcattgctcgggctatatgattggaatacacagaatgcacaagtgcagtcctatctgaaa
cgtttcttagaaagagcattgaatgacggcgcagacggatttcgatttgatgcagccaaa
catatagagcttccggatgacgggaattacggcagtcaattttggccgaatatcacaaat
acatctgcggagttccaatacggagaaatcctgcaagatagtgcctccagagatgctgca
tatgcgaattatatgaatgtgacagcatctaactatggacattccataagatctgcttta
aaaaatcgcaatcttagcgtgtcgaatatctctcattatgcatcagatgtgtctgtcgac
aagttagtcacatgggtagaatcgcatgatacgtatgccaatgatgaggaagagtctaca
tggatgagcgatgacgatattcgcttaggctgggcagtgattgcttctcgctcaggcagt
acgcctcttttcttttctaggcctgagggcggcggaaatggagtaagattcccggggaaa
agccaaataggcgatcgagggagtggtttatttgaagatcaggccatcactgcggtcaat
agatttcacaatgtgatggatggacagcctgaggaactctcgaatccgaatggaaacaac
cagatattcatgaatcagcgcggctcgcacggcgttgtgttggcaaatgcaggttcatct
tctgtcaccatcaatacgtcaacgaaattacctgatggcaggtatgataataaagctggg
aacggttcatttcaagtaacagacggtaaactgacaggcacgctcaatgccagatctgtg
gttgttctttatcctgatgatattgcaaatgcgcctcatgtcttccttgagaatgtcaaa
acaggtgtaacacattctttcaacgatcaactgacgatcactctgcgtgcagatgcgaat
acaacaaaagccgtttatcaaatcaataatgggcaagagacagcgtttaaggatggagac
caattaacgatcggaaaaggagattcgtttggcacaacatacaacatcacgttaacagga
acgaacagtgatggcgtaacgaggacccaggaatacagatttgtaaaaaaagacccatct
gcggccaaaaccattggctatcaaaacccaaatcattggggccaagtaaatgcttatatc
tataaacatgatgggggccgggcaatagaattggccggatcctggccgggaagagcaatg
gctaagaatgcagatggaatttacacgctgacgctgcctgcggatacggatacaacgaac
gccaaagtgatttttaataatggcagcgcccaagtgcccggacagaaccagcctggcttt
gattacgtgcaaaatggtttatataatgactctggcttaagcggttctcttcctcattga

DBGET integrated database retrieval system