KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2767Help
Entry
GYO_2767          CDS       T01635                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GYO_2767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(2566366..2566974)
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD
LNSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALADEINSVFGSFDKFKEQFA
AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVARLYSEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaacttccagaattaccctatgcgtatgatgctttagaaccgcatatcgac
aaggaaactatgactattcaccatacgaaacaccacaacacatacgttacaaatttaaac
aaagcggttgaaggaaacactgctcttgcaaacaaatcagttgaagagcttgttgcagat
cttaattctgttcctgaaaacatccgcactgcagtccgcaacaacggcggcggacacgcg
aaccacaaattattctggacgcttttatctccaaacggcggaggcgagccgactggcgcg
cttgctgatgagatcaacagtgtatttggaagctttgacaaattcaaagagcaattcgca
gctgcagcagctggacgcttcggttctggctgggcatggcttgttgtgaacaacggcaaa
cttgagatcacaagcacgccaaaccaagattctccgctttctgaaggcaaaacgcctatc
ttaggtcttgacgtttgggagcatgcatactaccttaactatcaaaaccgccgtcctgat
tacatttcagcgttctggaatgttgtgaactgggacgaagtggctcgtctatacagcgaa
gcaaaataa

DBGET integrated database retrieval system