KEGG   Burkholderia stagnalis: WT74_07620Help
Entry
WT74_07620        CDS       T04885                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00020  Citrate cycle (TCA cycle)
bstg00310  Lysine degradation
bstg00380  Tryptophan metabolism
bstg01100  Metabolic pathways
bstg01110  Biosynthesis of secondary metabolites
bstg01120  Microbial metabolism in diverse environments
bstg01130  Biosynthesis of antibiotics
bstg01200  Carbon metabolism
Module
bstg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bstg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bstg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WT74_07620 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    WT74_07620 (sucA)
   00380 Tryptophan metabolism
    WT74_07620 (sucA)
Enzymes [BR:bstg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WT74_07620 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AOK52588
UniProt: A0A104UTT5
LinkDB All DBs
Position
1:1714725..1717589
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLDNPASVPENWREYFDALQNVPATDGSNASD
VAHHPIVESFAQRAKANAFIPRESGGNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESTRATPSFSADEKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHSGKKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVILATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVISADDADGYVKAYRKAMDDGHHTIDPVLSNYKSKYAV
DWMPFLNRKWTDAADTAVPLAELKRLGERITTVPQDFKVHPLVERVINDRRNMARGDQPL
DWGMAEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIIATPKSLLRHKEAVSDLSELAKGSFQPVLGEIDGGIDAKKVKRVLACSGRVYF
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAELKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgtagaagaactgtacgatgcatatctcgataatccggcgtcagtgcccgagaactgg
cgagagtatttcgacgcgttgcagaatgtgcctgcaacggacggttcgaacgccagcgac
gtggcgcaccacccgatcgtcgagtcgttcgcccagcgtgcgaaggccaatgccttcatc
ccgcgcgaaagcggcggcaacctggcgactgcacgcaagcaggtccacgtccagtccctc
atcagcgcttatcgcttccttggctcgcaatgggccaatctcgatcccctgaagcgtcgc
gaacgtcccgccattcccgaactcgaacccgcgttctacgacttctccgaggccgacctc
gaccagacgttcagcgcgagcaacctgtacttcggtttcgaccaggcttcgctgcgcgac
atcgtcaagggcctgcgcgacacgtactgcggcacgatcggcgccgagtacatgtacatc
agcgatccggagcagaagcgctggtggcaggagcgcctggagtcgacccgtgcgacgccg
agcttctcggcagacgagaagaagcacatcctgaaccgcctgacggccgctgaaggcctc
gagcgctacctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcactcgggcaagaagggcgtgcaggaa
atcgtcatcggcatggcccaccgcggccgcctgaacgtgctcgtcaacacgctcggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgaccgaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcc
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcctgcaggtgctgccggtgcag
atccacggcgacgcggccttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgatgcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagccgtgatcctcgcg
acgcagatcgcgattgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggccacaacgagcaggacacgccggcggtcacgcagccgctgatg
tacaagaagatcgcacagcacccgggcacccgtgcgctgtacgccgagaagctcgtgcag
cagggcgtgatcagcgcggacgacgccgacggctacgtgaaggcgtaccgcaaggcgatg
gacgacggccatcacacgatcgacccggtgctctcgaactacaagagcaagtacgcggtc
gactggatgccgttcctgaaccgcaagtggacggacgcagccgacacggccgtgccgctc
gccgaactgaagcgcctcggcgaacgcatcacgaccgttccgcaagatttcaaggttcac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatggccgagcacctcgcgttcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgacgggccaggactcgggccgcggcacgttcacgcaccgccacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaa
ggccaggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctgggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggtctcacgatgctgctgccgcacggctatgaaggccagggcccg
gaacactcgtcgacccgtatcgagcgtttcctgcaactgtgcgcggatcacaacatgcag
gtcgtccagccgacgacgccggcgcagatcttccacctgctgcgccgccagatgatccgc
ctgttccgcaagccgctgatcatcgcgacgccgaagtcgctgctgcgtcacaaggaagcc
gtgtcggacctgtcggaactggcgaagggttcgttccagccggtgctgggcgagatcgac
ggcggcatcgatgcgaagaaggtcaagcgcgtgctggcctgctcgggccgcgtgtacttc
gacctcgtcgcacatcgccgcgaagcgaaggcgaacgacgttgcgatcatccgtatcgaa
cagctgtatccgttcgcgcacaagcagttcgaagctgagctgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcaaaaccagggcccgtggttctacgtcgaa
caccacctgaaggaaggcatgaaggaagggcaaaagctggcatacagcggccgtccggct
tcggcctcgccggcagtcggctattacgcgaagcactacgagcagcagaaggccctcgtc
gaaggtgcattcggccgcctgaagagcgcgtcgatcgcgaaataa

DBGET integrated database retrieval system