Bacillus subtilis subsp. subtilis 168: BSU16300 Help Entry BSU16300          CDS       T00010                                  Symbol fliL Name (RefSeq) flagellar protein FliL   KO K02415   flagellar protein FliL Organism bsu  Bacillus subtilis subsp. subtilis 168 Pathway bsu02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:bsu00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     BSU16300 (fliL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:bsu02035]     BSU16300 (fliL) Bacterial motility proteins [BR:bsu02035]  Flagellar system   Flagellar assembly proteins    M, S, P and L rings     BSU16300 (fliL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FliL Methyltransf_35 DUF2909 CcmE DUF4327 DUF4083 SAP_new25 Motif Other DBs NCBI-GeneID:  937103 NCBI-ProteinID:  NP_389512 Pasteur:  BG10250 UniProt:  P23452 A0A6M3ZB41 LinkDB All DBs Position 1701228..1701650 Genome browser AA seq 140 aa AA seqDB search MKKKLMIILLIILIVIGALGAAAYFVLGGKSEKSEAKKSIDEIVASSVDVEEITTNLKSD NIIRLAIKLETDSDKSKEELEKRDFQVKDAVISLLADTNADQIEGDKGKETFKKELKDKI NSYLQEGKVEKVYITSFNLQ NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgaagaaaaagttaatgatcatattactaattattcttatcgtaattggtgctctcggg gcggcggcttattttgttttaggcggaaagtccgaaaaaagtgaagcgaaaaaaagtatt gatgaaatcgttgcgtcttctgttgatgtagaagagatcacaacaaatttaaagtctgat aacattatccgtcttgctattaaacttgaaactgattctgataaatcaaaagaagaactt gagaaacgtgatttccaagtgaaagacgctgttatatcactgctggctgatacgaatgct gatcagattgagggagacaagggaaaagaaacctttaagaaggaactaaaagataaaata aatagctacctccaagaaggaaaagtagaaaaagtgtatattacctcctttaatctgcaa taa

DBGET integrated database retrieval system