KEGG   Bacillus subtilis subsp. subtilis 168: BSU20500Help
Entry
BSU20500          CDS       T00010                                 

Gene name
ligB
Definition
(RefSeq) DNA ligase-like protein LigB
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BSU20500 (ligB)
   03410 Base excision repair
    BSU20500 (ligB)
   03420 Nucleotide excision repair
    BSU20500 (ligB)
   03430 Mismatch repair
    BSU20500 (ligB)
Enzymes [BR:bsu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSU20500 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     BSU20500 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BSU20500 (ligB)
DNA replication proteins [BR:bsu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BSU20500 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BSU20500 (ligB)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BSU20500 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     BSU20500 (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     BSU20500 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
LinkDB All DBs
Position
2192370..2193182
Genome map
AA seq 270 aa AA seqDB search
MFVSPMLLHSIKEPFNDENYITELKFDGIRLILSKFDNQIKLYTRHNNEVTSKFPELMDL
DIPDGTVLDGEVIVAASGGAPDFEAVMERFMSKKSAHNIVYCVFDVIYKDGQSIAAKPLT
ERKTVLNSLELDHPNVFVIEGTQGNGLAYFNLAKEKNLEGIVIKKANSPYEINKRSHNWL
KVINYDYTEVLITGYTKKDIKFLLSYPDGTSAGFMEFMPHAERTKFHSMKQVKSESDEYV
FIEPILCNVKHRFKTKHGKLRIPSFESWRV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgtatcgccaatgctattgcattcaataaaagagccttttaacgacgagaactat
atcactgagctcaaatttgatggaatcagactcatcctttctaaatttgataatcagatt
aagctatacactcgtcacaacaacgaagtaacaagtaagttcccagaactcatggactta
gatattccagatggaacagtgctcgatggtgaagttattgtagctgcctcaggtggtgct
cctgactttgaggctgtaatggaacgttttatgtccaaaaaatcagctcataatattgtt
tactgtgtctttgatgttatctacaaagacggtcaatcaattgcagctaagccactcact
gagcgtaagacagttctgaattcacttgaactggatcatcctaatgtctttgttatagag
ggaactcaaggtaacggtcttgcttacttcaacctggccaaagaaaagaatttagaggga
atcgtaatcaagaaagctaactccccttatgagatcaataaacgttcgcataattggctt
aaagtgattaattacgattacactgaggttctcataactggctacaccaaaaaggatata
aaattccttctgtcttatcctgatggaacttcagctggatttatggaatttatgccacat
gcagaacgaactaagttccactctatgaaacaagttaagtctgaatctgatgaatatgta
tttatcgaacctatcttatgtaacgttaagcacagatttaagactaagcacggtaaactc
cgcataccttcctttgaatcctggagagtgtaa

DBGET integrated database retrieval system