KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_03941Help
Entry
BSUA_03941        CDS       T03443                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00240  Pyrimidine metabolism
bsul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsul00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSUA_03941 (tdk)
Enzymes [BR:bsul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BSUA_03941 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK zf-C4_ClpX AAA_19 AAA_22
Motif
Other DBs
NCBI-ProteinID: AIC42188
LinkDB All DBs
Position
complement(3775173..3775760)
Genome map
AA seq 195 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEAAVVSHNG
TSMTSYAISSAADIWDHISESTDVVAVDEVQFFDQEIVEVLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNIMAIAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGAAESYE
ARCRHHHEVPGKSKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaaacaaagcgggtggcttgagctgatttgcggcagcatgttctcgggg
aaatctgaagagctgatcagaagagtgaagagagcaacttatgccaagcaggaagtcagg
gtatttaagcctgtaattgataaccgatacagcgaagctgctgttgtctcccataatgga
acatcgatgacgagctatgccatttcgtctgctgcggacatttgggatcacatcagtgaa
agtacagatgtggttgcggttgatgaagtgcagttttttgatcaggaaattgttgaggtt
ttatcatctcttgccgataaaggctaccgtgtgatagcagcaggccttgatatggatttt
aggggagagccgttcggtgtcgtcccgaatatcatggcgattgcggaaagtgtgacaaag
ctgcaagccgtctgttctgtttgcggatcaccggcgagcagaacacagcgcctcattgac
ggcaaacctgcttcttacgatgatccggtcattttggttggtgcagctgaatcatatgaa
gcaagatgcagacatcatcacgaagtcccaggtaaatctaaaaaatag

DBGET integrated database retrieval system