KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_00295Help
Entry
BSUB_00295        CDS       T03442                                 

Gene name
ycbD
Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsut00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSUB_00295 (ycbD)
Enzymes [BR:bsut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BSUB_00295 (ycbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
268821..270320
Genome map
AA seq 499 aa AA seqDB search
MTRKNTKGAMGMSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNSTAED
VERAVTAANEAKTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPEAKGET
ARGIAILRYYAGEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIPIWKMAP
ALVYGNTVVIKPATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAEHDGVNAV
TFTGSNQVGKIIGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGAFRSTGQKC
TATSRVIVQSGIYERFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNCLSYIEKGKQ
EGASLLIGGEKLENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALIKVDSIEEALN
IANDVKFGLSASIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFGGMKQSSSHSRE
QGEAAKDFFTAIKTVFVKP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttgaccagaaaaaacacgaaaggggcaatgggcatgtctgtgatcacggaacaaaacacg
tacctcaactttattaacggagagtgggttaagtctcaatcaggcgatatggtcaaagtc
gaaaaccctgccgatgtgaatgatattgtcggatatgtacagaattcaacggctgaagat
gtggaacgtgccgtcaccgccgccaatgaagccaaaacggcttggagaaagctgacgggt
gccgagcgcggccaatacttatacaaaacagcggatatcatggagcagcgcttggaggaa
atcgccgcctgtgcaacgcgtgaaatgggtaaaacattgccggaagcgaagggagaaaca
gcccgggggattgccattctgcgctattacgccggagagggcatgcgaaaaacgggtgac
gtcattccgtctactgacaaagacgcgctcatgtttaccacccgtgttccgctcggtgtg
gtcggtgtgatttctccgtggaacttcccagtggcgattccgatttggaaaatggcgccg
gcattggtatacggcaataccgttgtcatcaaaccggcgacagaaacagctgtgacatgc
gcgaagatcattgcctgctttgaggaagcggggctcccggcaggggtcatcaatttggtg
acaggcccgggttctgttgtcgggcaggggcttgctgagcatgacggtgtaaacgccgtt
acgtttaccggttcaaatcaagtcggaaaaatcatcgggcaagccgctttagcgagggga
gccaaatatcagcttgagatgggcggcaaaaaccctgtcatcgtagctgatgacgctgac
cttgaagctgcggcagaagctgtcataacgggggccttccgttcaaccggccagaaatgc
accgcgacaagccgtgtcatcgtacaaagcggaatttacgagcgctttaaagaaaaactg
ctccagcgcacaaaagatattacaatcggagacagcttaaaagaggatgtctggatggga
ccgatagccagcaagaatcagcttgataactgcctgtcatacattgagaaaggcaaacag
gagggcgcttcccttttaataggaggagaaaagctggagaacggaaagtatcaaaacggc
tattatgttcagcctgccatctttgacaatgtgacatctgagatgacaattgcccaggag
gaaattttcggtccggtgatcgccttgatcaaggtggactcgatagaggaggcgctgaac
atcgccaatgatgtgaagttcggtttaagtgcatccatcttcacggaaaacatcggccga
atgctttctttcattgatgaaatcgatgccgggctggttcggatcaatgcagaaagcgca
ggtgttgagctgcaggcgccttttggcggcatgaagcagtcgagctcccactcccgagaa
cagggtgaggcagcgaaggactttttcacagcgatcaaaactgtttttgtgaagccgtaa

DBGET integrated database retrieval system