KEGG   Bacillus subtilis XF-1: C663_0236Help
Entry
C663_0236         CDS       T02459                                 

Gene name
ycbD
Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C663_0236 (ycbD)
Enzymes [BR:bsx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     C663_0236 (ycbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
261871..263343
Genome map
AA seq 490 aa AA seqDB search
MGMSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNSTAEDVERAVVAAN
EAKTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPEAKGETARGIAILRY
YAGEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIPIWKMAPALVYGNTVV
IKPATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAEHDGVNAVTFTGSNQVG
KIIGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGAFRSTGQKCTATSRVIVQ
SGIYERFKEKLLHRTKDITIGDSLKEDVWMGPIASKNQLDNCLSYIEKGKQEGASLLIGG
EKLENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALIKVDSMEEALNIANDVKFGL
SASIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFGGMKQSSSHSREQGEAAKDFF
TAIKTVFVKP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgtctgtgatcacggaacaaaacacgtacctcaactttattaacggagagtgg
gttaagtctcaatcaggcgatatggtcaaggtcgaaaaccctgccgatgtgaatgatatt
gtcggatatgtacagaattcaacggctgaagatgtggaacgtgccgtcgtcgccgccaat
gaagccaaaacggcttggagaaagctgacgggtgccgagcgcggccaatacttatacaaa
acagcggatatcatggagcagcgcttggaggaaatcgccgcctgtgcaacgcgtgaaatg
ggtaaaacattgccggaagcgaagggagaaacagcccgggggattgccattctgcgctat
tatgccggagagggtatgcgaaaaacgggtgacgtcattccgtctactgacaaagacgcg
ctcatgtttaccacccgtgttccgctcggtgtggtcggcgtgatttctccgtggaacttc
ccagtggcgattccgatttggaaaatggcgccggcattggtatacggcaataccgttgtc
atcaaaccggcgacagaaacagctgtgacatgcgcgaagatcattgcctgctttgaggaa
gcggggctcccggcaggggtcatcaatttggtgacaggcccgggttctgttgtcgggcag
gggcttgctgagcatgacggtgtaaacgccgttacgtttaccggttcaaatcaagtcgga
aaaatcatcgggcaagccgctttagcgaggggagccaagtaccagcttgagatgggcggc
aaaaaccctgtcatcgtagctgatgatgctgaccttgaagctgcggcagaagctgtcata
acgggggccttccgttcaaccggccagaaatgcaccgcgacaagccgtgtcattgtacaa
agcggaatttatgagcgctttaaagaaaaactgcttcaccgcacaaaagatattacaatc
ggagacagcttaaaagaggatgtctggatgggaccgattgccagcaagaatcagcttgat
aactgcctgtcatacattgagaaaggcaaacaggagggcgcttcccttttaataggagga
gaaaagctggagaacggaaagtatcaaaacggctattatgttcagcctgccatctttgac
aatgtgacatctgagatgacaattgcccaggaggaaattttcggtccggtgatcgccttg
atcaaggtggactcgatggaggaggcgctgaacatcgccaatgatgtgaagttcggttta
agtgcatccatcttcacggaaaacatcggccgaatgctttctttcattgatgaaatcgat
gccgggctggttcggatcaatgcagaaagcgcaggtgttgagctgcaggcgccttttggc
ggcatgaagcagtcgagctcccactcccgagaacagggtgaggcagcgaaggactttttc
acggcgattaaaaccgtttttgtgaagccgtaa

DBGET integrated database retrieval system